(data stored in SCRATCH zone)

EMBL: CP000509.PE343

CP000509.PE343       Location/Qualifiers
FT   CDS_pept        371696..373204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0349"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bja:blr2806 nitrite extrusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79893"
FT                   /db_xref="GOA:A1SDK8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK8"
FT                   /protein_id="ABL79893.1"
FT                   /translation="MALTSLHTDAAEASPIRRRTGRWIDDWRPEDPDFWANGGQQVARR
FT                   NLVWSVFAEHLGFSVWLIWSVSSAFLLAQGFTFTPQQLFLLVAIPNLVGSLLRVPYTLA
FT                   VPRFGGRNWTMVSAGLLLVPTLGFAYAVTDPSTPYWVFCLIAASAGFGGGNFASSMANI
FT                   NFFYPTAKKGAALGLNAAGGNLGVSLIQFFLPLIVGGAAIFGLAKASPGGIHLERAAWV
FT                   YAGLAIVATAAAYFFMDNLGTARSSAREQLGVLKHKQTWVMSFLYIGTFGSFIGYSAAM
FT                   PLLIKLNFWVPEPAPLGTGIYFAYFAFLGALVGSITRPLGGWLADRYGGARVTLGAFTG
FT                   IILSTLGVLWTLLQLTPNPAADPAIAADNKSWFPYFLGFFLLVFAATGIGNGSTYKMIP
FT                   AIFRTEAERATAVGTEERTAALLAATKRASAAIGIIGAVGAIGGFLIPITFSSPWVSDP
FT                   MEATKTAFVIFTVFYLACAATTWVVYLRRPAEHKAHLSYAGAGI"
     atggccctca cttccttgca caccgacgcc gccgaggcgt cccccatccg ccgccggacc        60
     ggccgctgga tcgacgactg gcgcccggag gacccggact tctgggcgaa cggcggccag       120
     caggtcgccc gtcgcaacct ggtctggtcg gtcttcgccg agcacctcgg attctccgtg       180
     tggctgatct ggagcgtcag ctcggcgttc ctgctcgccc agggcttcac gttcaccccg       240
     cagcagctgt tcctcctcgt cgcgattccc aacctggtcg gctcgctgct gcgcgtcccc       300
     tacaccctcg ccgtgccgcg gttcggcggc cgcaactgga ccatggtgag cgccggcctg       360
     ctgctggtcc cgacgctcgg cttcgcctac gcggtgaccg atccgagcac gccgtactgg       420
     gtcttctgcc tgatcgcggc gtccgccggc ttcggcggcg ggaacttcgc gagctcgatg       480
     gcgaacatca acttcttcta cccgaccgcc aagaaggggg ccgccctcgg cctcaacgcc       540
     gccggcggga acctcggcgt ctcgctgatc cagttcttcc tgccgctgat cgtcggtggc       600
     gcggcgatct tcggcctggc caaggccagc cccggcggca tccacctcga gcgggccgcc       660
     tgggtgtacg ccggtctcgc gatcgtggcc acggcggcgg cctacttctt catggacaac       720
     ctcgggaccg ccaggtcctc ggccagggag cagctcggcg tcctcaaaca caagcagacc       780
     tgggtgatgt cgttcctcta catcggcacg ttcggctcgt tcatcggcta ctccgccgcg       840
     atgccgctgc tgatcaagct caacttctgg gtgcccgagc cggccccgct cggcaccggc       900
     atctacttcg cctacttcgc cttcctcggc gcgctggtcg gctcgatcac ccgcccgctc       960
     ggtggctggc tggccgacag gtacggcggc gccagggtca ccctcggcgc cttcaccggg      1020
     atcatcctca gcaccctcgg cgtgctgtgg acgctgctgc agctgacccc gaaccctgcc      1080
     gcggacccgg cgatcgccgc cgacaacaag tcctggttcc cgtacttcct cgggttcttc      1140
     ctgctcgtct tcgctgccac cggcatcggc aacggctcga cgtacaagat gatccccgcg      1200
     atcttccgga ccgaggccga gcgggcgacc gccgtgggca ccgaggagcg caccgccgcg      1260
     ctcctcgccg ccaccaagcg ggcctcggcc gcgatcggca tcatcggcgc ggtcggcgcc      1320
     atcggcgggt ttctgatccc gatcacgttc agctcgccgt gggtgagcga cccgatggag      1380
     gccaccaaga ccgcgttcgt catcttcacg gtcttctacc tggcctgcgc ggccaccacc      1440
     tgggtggtct acctgcgcag gcccgccgag cacaaggcgc acctcagcta cgccggcgcc      1500
     gggatctga                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page