(data stored in SCRATCH zone)

EMBL: CP000509.PE345

CP000509.PE345       Location/Qualifiers
FT   CDS_pept        375404..376786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0351"
FT                   /product="assimilatory nitrate reductase (NADH) beta
FT                   subunit"
FT                   /EC_number="1.7.1.1"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: mmc:Mmcs_3231 nitrite reductase (NAD(P)H)
FT                   large subunit, NirB"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79895"
FT                   /db_xref="GOA:A1SDL0"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL0"
FT                   /protein_id="ABL79895.1"
FT                   /translation="MRVVVVGAGMAAARLADGLHDHDVTLLGDEPHPPYNRILLSAVLE
FT                   GTHDPTAIAMPLRGDVDLRLGTRVVEIHREDRDVELADRSRVPYDRLVLATGSIPTLPP
FT                   IRGLVRMDGRLDERVHAFRSLEDCRRLDVAVPAAHRAVVVGGGLLGLQVARALAVRGVA
FT                   TEVVEGGDHLLRSQVGPRAGAILARDLGRLGTRVYTGARAVRLTDEGLRLDNGYTLATD
FT                   LVVLTAGGRPSTALARRAGLEVRRGIVVDERLRTSDHRIHAIGDCAQHGTQVTGFVPPA
FT                   WEQAGLLARQLRGEDVTYAGSRSVARLRATGLEVAVLGEPERAEGQVVEVANPVTGTHR
FT                   KLVVRDGVIVAATLVGDLSRIGLITQHYDRGTVLGASEPGDLLIGDRPAAQVDLPDDAE
FT                   VCACAGVSAGAIRACASLADARETTRATTGCGGCAAAVRQLLAARLSPGPSLGTTLEGT
FT                   PR"
     atgagggtcg tcgtcgtcgg agccgggatg gccgccgccc gcctcgccga cggtctccac        60
     gaccacgacg tgaccctgct cggggacgag ccgcacccgc cgtacaaccg gatcctgctc       120
     tccgccgtcc tggagggcac ccatgatccg accgcgatcg cgatgccgct gcgcggcgat       180
     gtcgacctgc ggctcgggac ccgcgtcgtg gagatccacc gcgaggaccg cgacgtcgag       240
     ctcgccgacc ggtcccgggt gccctacgac cggctggtgc tcgccaccgg cagcatcccg       300
     acgctcccgc cgatccgcgg gctggtgcgg atggacggcc ggctcgacga gcgcgtgcac       360
     gcgttccgca gcctggagga ctgccggcgg ctcgacgtgg cggtcccggc ggcgcaccgg       420
     gcggtcgtcg tcggcggcgg gctgctgggc ctgcaggtcg cgcgggcgct cgcggtccgc       480
     ggcgtcgcca ccgaggtcgt cgagggcggt gaccacctgc tgcgcagcca ggtcggcccg       540
     cgggccgggg cgatcctggc tcgcgacctc ggccggctgg gcacccgcgt ctacaccggc       600
     gccagggccg tccggctgac cgacgagggt ctgcggctcg acaacggata cacgctggcg       660
     accgacctcg tggtgctcac cgccggcggc cgcccctcga ccgcgctggc ccggcgggcc       720
     gggctggagg tccgccgcgg catcgtggtc gacgagcggc tgcgcaccag cgaccaccgc       780
     atccacgcga tcggcgactg cgcccagcac gggacacagg tgaccggatt cgtgccgccg       840
     gcgtgggagc aggccgggct gctggcacgg cagctgcgcg gcgaggacgt gacgtacgcc       900
     ggcagccgca gcgtcgcccg gctgcgggcg accgggctcg aggtcgccgt gctcggcgag       960
     cccgagcgcg ccgagggcca ggtggtcgag gtcgccaacc cggtcaccgg gacccaccgc      1020
     aagctcgtgg tccgcgacgg cgtgatcgtc gccgcgaccc tggtcggcga cctctcccgg      1080
     atcggcctga tcacccagca ctacgaccgc ggcacggtcc tcggcgccag cgagcccggc      1140
     gacctgctga tcggcgatcg tccggccgcc caggtcgacc tccccgacga cgcggaggtc      1200
     tgcgcgtgcg cgggcgtgag cgccggggcg atccgcgcct gcgcctcgct cgcggacgcg      1260
     cgcgagacca cccgcgccac cacgggctgc gggggctgtg ccgccgcggt ccgccagctg      1320
     ctcgcagccc gtctgtcgcc aggcccgtcc ctgggcacca ccctggaagg aaccccccga      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page