(data stored in ACNUC1104 zone)

EMBL: CP000509.PE347

CP000509.PE347       Location/Qualifiers
FT   CDS_pept        379296..379673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0353"
FT                   /product="assimilatory nitrite reductase (NAD(P)H) small
FT                   subunit"
FT                   /EC_number="1.7.1.4"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], small subunit;
FT                   PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   fra:Francci3_0795 nitrite reductase (NAD(P)H) large
FT                   subunit, NirD"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79897"
FT                   /db_xref="GOA:A1SDL2"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL2"
FT                   /protein_id="ABL79897.1"
FT                   /translation="MSTSTGPAAGATYTTVCGLDQIEVEGGVVALVDGVAVAIFRTHDG
FT                   NVYAISNYDPVSRASVLARGIVGTRGDVPVVASPMHKQAYDLRTGQCLDDAAVRVPTYD
FT                   VRVIDGTVHVGGPRPEHQDST"
     gtgagcacgt cgaccgggcc cgccgcgggg gcgacgtaca cgaccgtctg cgggctcgac        60
     cagatcgagg tcgagggcgg cgtcgtggcg ctcgtcgacg gcgtcgcggt cgcaatcttc       120
     cggacacacg acggaaacgt ctacgcgatc tccaactacg accctgtctc cagggcgtcg       180
     gtgctcgccc gcggaatcgt cggcacacgt ggcgacgtcc ccgtggtcgc ctcgccgatg       240
     cacaagcagg cctacgacct gcgcaccggg cagtgcctcg acgacgcggc ggtccgggtc       300
     ccgacgtacg acgtccgggt gatcgacggc accgtgcacg tcggcggtcc ccgaccggag       360
     caccaggaca gcacgtga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page