(data stored in ACNUC1104 zone)

EMBL: CP000509.PE349

CP000509.PE349       Location/Qualifiers
FT   CDS_pept        complement(380814..382331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0355"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: sma:SAV7117
FT                   transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79899"
FT                   /db_xref="GOA:A1SDL4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL4"
FT                   /protein_id="ABL79899.1"
FT                   /translation="MSTGLDAAPGIVAVAVVTIATLVIGTWGLRFSRTTSDFFVASRTV
FT                   RPRLNASAIGGEYLSAASFLGVAGLVLTFGADMLWYPVGWTAGYLVLLVLVAAPLRRSG
FT                   AYTLPDFAEARLGSRSVRAVCSLLVVAVGWLYLLPQFQGAGITLRSTLGAPTWVGPVIV
FT                   GLVVLANVTSGGMRSITFVQAFQYWLKLTALLVPGAVLLVVWAGDSAPLRAGSDGWSVP
FT                   LAAGGNQGLYVTYSLIIATFLGTMGLPHVVVRFYTNPDGRAARRTTLVVLALLGVFYLL
FT                   PPLYGALGRVYAPSLAESGRSDALVLELPRIMLDGPAGEVLTGLVTAGAFAAFLSTSSG
FT                   LSIAVSGVLSQDVTGRPWAGRRLGGVAAFRVGAVVAVTVPCVVALAAPNLGVARAVGLA
FT                   FAMAASTFCPLLLLGIWWRRLTPAGALAGLLAGGVGSGVAIAWTLATSRPSGWADALMG
FT                   QPAAWTFPLALTTMVVVSLATAHRIPTHAGRFLVRLHTPETLGLDRS"
     gtgagcaccg ggctggacgc cgcccctggc atcgtcgcgg tggcggtggt gacgatcgcg        60
     acgctggtca tcggcacctg ggggctgcgg ttctcccgta cgacgagcga cttcttcgtg       120
     gcctcgcgca cggtccggcc gcggctgaac gcgagtgcga tcggcggcga gtacctctcg       180
     gccgcctcct tcctcggcgt cgccgggctg gtgctgacct tcggcgccga catgctgtgg       240
     taccccgtcg gctggaccgc cggctacctc gtgctgctgg tgctggtcgc cgcgccgctg       300
     cgccgctcgg gtgcgtacac gctgccggac ttcgccgagg cgcggctcgg gtcgcgctcg       360
     gtgcgcgcgg tctgctcgct gctcgtcgtc gccgtcggct ggctctacct gttgccgcag       420
     ttccagggcg ccggcatcac gctgcgctcg accctcgggg cccccacctg ggtcgggccg       480
     gtgatcgtcg gcctggtcgt gttggcgaac gtcacctcgg gcgggatgcg cagcatcacg       540
     ttcgtccagg ccttccagta ctggctcaag ctcaccgctc tcctggtccc gggggcggtg       600
     ctgctggtcg tctgggccgg cgactccgct ccgctgcggg cgggctccga cgggtggtcg       660
     gtgcccctgg cggcgggcgg caaccagggc ctctacgtga cctactcgct gatcatcgcg       720
     acgttcctgg gcaccatggg gctgccgcac gtggtcgtcc gcttctacac caaccccgac       780
     ggtcgcgcgg cccgccgtac gacgctcgtc gtgctggcgc tgctcggcgt gttctacctg       840
     ctgccgccgc tgtacggcgc cctcgggcgg gtctacgcgc cctcgctcgc cgagtccggg       900
     cgctcggacg cgctggtgct cgagctcccc cggatcatgc tcgacgggcc ggccggggag       960
     gtgctcaccg ggctggtgac cgcgggcgcg ttcgccgcgt tcctctccac gtcctccgga      1020
     ctgtcgatcg cggtgtccgg cgtgctcagc caggacgtga ccggccgccc gtgggccggc      1080
     cggcggctcg gcggagtcgc ggcgttccgg gtgggggcgg tcgtcgcggt caccgtgccg      1140
     tgcgtggtgg cgctcgcggc gccgaacctc ggcgtcgccc gggcggtcgg gttggccttc      1200
     gcgatggccg cttcgacgtt ctgcccgctg ctgctgctcg ggatctggtg gcgccggctc      1260
     acccccgccg gtgcgttggc ggggctgctg gccggcggcg tcggcagcgg cgtcgccatc      1320
     gcgtggacgc tcgccacgtc ccgtccctcg ggctgggccg acgcgctcat gggccaaccc      1380
     gccgcctgga ccttccccct cgcgctgacc acgatggtcg tcgtgtcgct ggcgaccgcc      1440
     caccggatcc ccacccacgc cggccggttc ctggtgcgcc tgcacacccc cgagacgctc      1500
     ggcctggacc gcagctga                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page