(data stored in ACNUC1104 zone)

EMBL: CP000509.PE351

CP000509.PE351       Location/Qualifiers
FT   CDS_pept        complement(382702..383451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0357"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: sma:SAV7115 regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79901"
FT                   /db_xref="GOA:A1SDL6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL6"
FT                   /protein_id="ABL79901.1"
FT                   /translation="MSAPAAPVPRLRALVVDDERPALDELRYLLERDDRVREVLTTDSA
FT                   TEGLRILRDLDVDVVFLDIQMPGLTGLELAQVLSRFRTPPGIVFVTAHEAHAVEAFDVH
FT                   AVDYVLKPVRADRLAEAVRRVVAGTDRAANGDDMRVAVERGGVTRFLNRSDITHVEAHG
FT                   DYARLHTGDGSHLVRTPLAALEEEWAGAGFVRIHRSLLVSLAHVREVRMDAGRCAVVVG
FT                   EPPVELGVSRRHTRELRELLLQYRTGP"
     gtgagcgcgc cggcggctcc cgtcccgcgg ctccgggcgc tcgtcgtcga cgacgagcgg        60
     cccgcgctcg acgagctgcg ctacctgctc gagcgcgacg accgcgtccg cgaggtgctg       120
     accaccgact cggcgaccga ggggctccgg atcctgcgcg acctcgacgt ggacgtggtg       180
     ttcctcgaca tccagatgcc ggggctgacc ggcctcgagc tcgcgcaggt gctcagccgg       240
     ttccgcaccc cacccggcat cgtgttcgtc accgcccacg aggcccacgc cgtggaggcc       300
     ttcgatgtgc acgccgtcga ctacgtgctc aagccggtgc gcgccgaccg gctggccgag       360
     gcggtccgcc gggtggtggc cggcaccgac cgggcggcga acggcgacga catgcgggtc       420
     gcggtggagc gcggcggcgt cacccgcttc ctgaaccgct ccgacatcac ccacgtggag       480
     gcgcacggcg actacgcgcg gctgcacacc ggcgacggct cccacctggt gcgcaccccg       540
     ctcgccgccc tggaggagga gtgggcgggt gccggcttcg tgcggatcca ccggtccctg       600
     ctggtctcgc tcgcccacgt gcgcgaggtg cggatggacg cgggccgctg cgcggtcgtc       660
     gtcggcgagc cgccggtcga gctcggcgtc agccgacggc acacccggga gctgcgcgag       720
     ctgctgctcc agtaccggac cgggccgtga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page