(data stored in SCRATCH zone)

EMBL: CP000509.PE352

CP000509.PE352       Location/Qualifiers
FT   CDS_pept        complement(383448..384572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0358"
FT                   /product="histidine kinase internal region"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase internal region; KEGG:
FT                   sma:SAV7118 putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79902"
FT                   /db_xref="GOA:A1SDL7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL7"
FT                   /protein_id="ABL79902.1"
FT                   /translation="MSAMTRPWRRRHLGTEADRATFRTLHTASLASPALREGLTRTSAE
FT                   RSIRHLHDLLGGPALALTDTATTLAWHGTGQHHEEQCPGLAVATVERGRTRMFDREELP
FT                   CDVSGCPVRSAIVSPLVVEERVIGTLQVFPAYATAGLARAADEVAQWVSSQLELAELDA
FT                   SRNRLMEAEVRALRAQISPHFIYNSLGAIASFVRTDPDRARDLLLEFADFTRYSFRRHG
FT                   EYTTLAEELRSVERYLLLEQARFGDRLQVTLRIAPEVLPVAVPFLCIQPLVENAVRHGL
FT                   ETAERGGHIRIVARDQGQECVIEVEDDGTGEDPDVVRRALAGDAALDSTGLGNVDGRLR
FT                   NAFGDDFGLAVETAPGAGTKVVVRVPKFAPGVHA"
     atgtcggcca tgactcgccc gtggcgtcgc cggcatctcg ggacggaggc cgaccgggcc        60
     acgttccgca cgctgcacac ggcctcgctc gcctcgccgg cgctgcggga ggggctgacc       120
     cgcaccagcg ccgagcgcag catccgccac ctgcacgacc tgctcggcgg cccggccctc       180
     gcgctcaccg ataccgccac gacgctcgcc tggcacggca ccgggcagca ccacgaggag       240
     cagtgtccgg ggctcgcggt cgcgacggtc gagcgcgggc gcacccggat gttcgaccgc       300
     gaggagctgc cgtgtgatgt gtccggctgt ccggtccgct ccgcgatcgt cagcccgctc       360
     gtcgtcgagg agcgggtgat cggcacgctg caggtcttcc ctgcctatgc gaccgcgggc       420
     ctggcccggg cggccgacga ggtcgcccag tgggtcagct cgcagctcga gctcgccgag       480
     ctcgacgcgt cccggaaccg gctgatggag gccgaggtcc gtgccctgcg ggcccagatc       540
     agcccacact tcatctacaa ctcgctgggc gccatcgcga gcttcgtgcg caccgacccc       600
     gaccgggccc gggacctgct cctggagttc gcggacttca cccgctactc gttccgccgg       660
     cacggcgagt acacgacgct cgccgaggag ctgcgctcgg tggagcgcta cctgctgctg       720
     gagcaggccc ggttcggcga ccggctccag gtgacgctgc gcatcgcgcc cgaggtgctc       780
     ccggtcgccg tacccttcct ctgcatccag ccgctcgtcg agaacgccgt ccggcacggc       840
     ctcgagacgg cggagcgcgg cggtcacatc cggatcgtcg cccgcgacca gggccaggag       900
     tgcgtgatcg aggtggagga cgacggcacg ggcgaggacc ccgacgtcgt acggcgcgcc       960
     ctcgcgggcg acgccgccct cgactccacc ggcctgggca acgtcgacgg ccggctccgc      1020
     aacgccttcg gcgacgactt cggcctcgcg gtggagaccg caccgggcgc gggcaccaag      1080
     gtcgtggtca gggtgccgaa gttcgctccc ggggtgcacg cgtga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page