(data stored in ACNUC1104 zone)

EMBL: CP000509.PE355

CP000509.PE355       Location/Qualifiers
FT   CDS_pept        complement(387475..388344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0362"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; KEGG: sco:SCO3558 morphological
FT                   differentiation-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79905"
FT                   /db_xref="GOA:A1SDM0"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM0"
FT                   /protein_id="ABL79905.1"
FT                   /translation="MWTRRFDTVPVDGEWTAPAYDGAMATRSTAAFFDLDKTIIAKSST
FT                   LAFSKPFQAGGLISRRAVLRSAYAQFVYLVGGADHDQMEKMRQFMSQLCAGWDVATVRE
FT                   IVADTLHNIVDPLVYDEAVSLIEEHRLAGRDVVVVSASGAEVVEPIAAMLGADRVIATR
FT                   MEIAEGRYTGGIEYYAYADEKARAIEDLAAAEGYDLASSYGYSDSVTDVPMLEAVGHAH
FT                   AVNPDKELRRIAAERGWPVLVFTKPVALRTRVPLPPAKPTLAALAVGGVVAVGGVLWAN
FT                   SRKRRPSA"
     ttgtggacaa ggcggttcga cacggtgcct gtggacggcg agtggactgc gcccgcctac        60
     gatggcgcca tggcgacccg gtccaccgcg gccttcttcg atctcgacaa gacgatcatc       120
     gccaagtcga gcacgttggc gttcagcaag ccgttccaag cgggcgggct gatctcgcgg       180
     cgcgccgtgc tgcgctcggc gtacgcccag ttcgtctacc tggtcggcgg cgcggaccac       240
     gaccagatgg agaagatgcg gcagttcatg tcgcagctgt gcgccgggtg ggacgtcgcg       300
     accgtccggg agatcgtcgc ggacaccctg cacaacatcg tcgacccgct ggtgtacgac       360
     gaggcggtca gcctgatcga ggagcaccgc ctggccgggc gcgacgtggt cgtcgtctcg       420
     gcctccggtg ccgaggtggt cgagccgatc gccgcgatgc tcggcgcgga ccgggtgatc       480
     gcgacccgga tggagatcgc ggagggccgc tacaccgggg gcatcgagta ctacgcgtac       540
     gcggacgaga aggcccgcgc catcgaggac ctggccgccg cggagggcta cgacctcgcg       600
     agcagctacg gctacagcga ctcggtgacg gacgtgccga tgctcgaggc ggtgggccac       660
     gcccacgcag tcaacccgga caaggagctg cgccggatcg cggccgagcg cggctggccg       720
     gtgctggtgt tcaccaagcc ggtggcgctg cgcacccggg tcccgctgcc gccggcgaag       780
     cccaccctgg ccgccctcgc ggtgggcggc gtggtggccg tcggcggggt gctgtgggcc       840
     aactcgcgca agcgacggcc cagcgcctga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page