(data stored in ACNUC1104 zone)

EMBL: CP000509.PE358

CP000509.PE358       Location/Qualifiers
FT   CDS_pept        390598..391374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0365"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   sco:SCO3555 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79908"
FT                   /db_xref="GOA:A1SDM3"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM3"
FT                   /protein_id="ABL79908.1"
FT                   /translation="MTAVAVGAAALAMLLLVRPPARPAASGAAVVERRWVPVAVLVAGV
FT                   VAALAMPRLGGLALVLSGTATGAAGLWRRRRRRRAAERVAAQVLDTCELLAGELTAGRP
FT                   PGEALQRAAASWPPLARVAEAFRVGADVPSALRVLAADLEGARDLRVVAAAWQVAHRTG
FT                   QGLASAVERVAESLRAGAATRRMVTGELGSARATARLVAGLPVLALAMGSGAGGDPWGF
FT                   LLGHPAGLLCLAGGLAFGLAGLWWIEAIAAAAEESW"
     atgaccgcgg tcgcggtcgg tgccgcggcg ctcgcgatgc tgctgctggt ccggccaccg        60
     gcccgtcccg cggcatcggg ggcggcggtc gtggagcgcc gctgggtgcc ggtggccgtg       120
     ctcgtggccg gggtcgtggc cgcgctcgcg atgccgcgcc tcggtggcct cgccctcgtg       180
     ctcagcggga ccgcgacggg tgccgccggg ctctggcggc gccggcgccg gcgtcgggcc       240
     gccgagcggg tggccgcgca ggtgctggac acctgcgagc tgctggccgg cgagctcacc       300
     gccgggcggc cgcccggcga ggcactgcag cgggcagccg cgtcctggcc gccgctggcc       360
     cgggtcgccg aggcgttccg ggtgggagca gacgtgccgt ccgccctgcg cgtcctggcc       420
     gccgacctcg agggcgcgcg ggacctgcgc gtcgtcgcgg cggcctggca ggtcgcccac       480
     cggaccggac agggtctcgc ctcggccgtc gagcgggtgg cggagtcgtt gcgtgccggt       540
     gccgcgaccc ggcggatggt caccggggag ctcggctcgg cccgcgccac cgcccgcctg       600
     gtcgcgggac tgccggtgct cgccctcgcc atggggtcgg gcgccggtgg cgacccctgg       660
     ggcttcctgc tcggccatcc cgctggtctc ctgtgccttg ccggcgggtt ggccttcgga       720
     ctggccggcc tgtggtggat cgaggcgatc gccgccgcgg ccgaggagtc gtggtga          777
//

If you have problems or comments...

PBIL Back to PBIL home page