(data stored in ACNUC1104 zone)

EMBL: CP000509.PE359

CP000509.PE359       Location/Qualifiers
FT   CDS_pept        391371..392093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0366"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   tfu:Tfu_0126 putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79909"
FT                   /db_xref="GOA:A1SDM4"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM4"
FT                   /protein_id="ABL79909.1"
FT                   /translation="MSALPALLPVLAAAMAAALLLPPRPTLPGARSPSDHAPSPGWLHR
FT                   HRLLWSGLAGTGALVLVGGPAGPPAALVAAVAAWTVIGRAEPPDVRRRREAVRRDLPHV
FT                   VDLFAATLRGGAAPADGIALVCTALPGPAADRLAGVAARLALGLDPGQVWSALADDPHL
FT                   GRLGRTLARAHSSGAPVVAAVERLADDLARSARAETEERARAVGVKAALPLGLCLLPAF
FT                   VLIGIVPLVVALLASLDI"
     gtgagcgcgc tgccggcgtt gcttccggtg ctcgcggcgg ccatggcggc ggcgctcctg        60
     ctccctcctc gcccgaccct gcccggcgca cggtccccga gcgaccacgc gccgtccccc       120
     gggtggctgc accggcaccg actgctgtgg agtgggctgg ccggcaccgg cgccctggtt       180
     ctcgtcggcg gtccggccgg cccgccggcc gccctggtcg cggcggtggc cgcctggacg       240
     gtgatcgggc gcgccgagcc gcccgacgta cgacgccgcc gcgaggcggt gcgccgggac       300
     ctgccgcacg tcgtggacct gttcgccgcc accctgcgcg gcggcgccgc tcccgccgac       360
     gggatcgcac tggtctgcac cgccctcccc ggcccggccg ccgaccggct cgcgggggtc       420
     gcggcccggc tcgcgctcgg gctggacccg ggccaggtct ggtcggcact cgccgacgac       480
     ccccatctcg gccgcctcgg ccgcaccctc gcccgcgcgc actcctcggg ggcgccggtg       540
     gtggccgcgg tcgagcggct cgccgacgac ctcgcccggt ccgctcgcgc cgagaccgag       600
     gagcgggccc gggcggtcgg cgtgaaggcc gccctgcccc tcggcctgtg cctgttgccg       660
     gcgttcgtgc tgatcggcat cgtcccgctc gtggtcgccc tcctcgcgag cctcgacatc       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page