(data stored in ACNUC1104 zone)

EMBL: CP000509.PE36

CP000509.PE36        Location/Qualifiers
FT   CDS_pept        complement(39830..41461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0036"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein;
FT                   KEGG: rxy:Rxyl_2477 thiamine pyrophosphate enzyme-like TPP
FT                   binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79586"
FT                   /db_xref="GOA:A1SCQ1"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCQ1"
FT                   /protein_id="ABL79586.1"
FT                   /translation="MPHVGDAMIDAIASAGVRRLYTVPGESFLEVLDAADRHPALRQFS
FT                   TRHESGASFMADADAKTSGVPAVAMATRGPGAANLSIGVHTAHQDGTPMLVLIGDVETP
FT                   RIFRGAFQEVDLPAFYRPITKAAMTARRGDRLPEMVTDALRIAVSGRPGPVMISLPADL
FT                   LAEEFTGPAPAPLAPVAPAGCPPETVRRLRSTLERAQRPVVIAGAGVRHATDRLVALCE
FT                   AYGLGVYAAMRRQDVFPNDHPLYLGHLGVSPAPGTVDALREADVVLILGAALDQMTTQQ
FT                   FTLPAASAHRIHVDADPLTLGAGLPVDEAVVAEPRELIEALLAEPPTAPHRAWDAAHRR
FT                   FLESTCAPPRTPARGCDPGAVIEAMKRAWPADTIVTSDAGNFSGFLHQYWRFTTPRSQA
FT                   APINGAMGYAVPGAVGAKAASPDRHVLGVVGDGGFLMTGSEVETAVRYGLPLTIVVLRN
FT                   GLYGTIAMHQAQEMGRLSAVDIGDVDLAAYGRSLGAEGITVEEPGQLDEAMRTAATSDA
FT                   VTVVDVVTDPDLITASGRLSEMFQTS"
     atgccccatg taggcgacgc gatgatcgac gcgatcgcga gcgcaggcgt ccgacggctc        60
     tacaccgtgc ccggcgagag cttcttggag gtgctcgacg ccgccgaccg gcaccccgcg       120
     ctccgccagt tctccacccg gcacgagtcg ggcgcctcgt tcatggccga cgcggacgcc       180
     aagacgtccg gcgtgcccgc cgtcgcgatg gccacccggg gtccgggcgc ggcgaacctc       240
     agcatcggcg tgcacaccgc tcaccaggac ggcacgccca tgctggttct gatcggggac       300
     gtggagacgc cgcggatctt ccgcggcgcc ttccaggagg tcgatctgcc ggcgttctac       360
     cggccgatca ccaaggcggc catgaccgcc cgccgcgggg accggctgcc cgagatggtg       420
     accgacgcgc tccggatcgc agtctccgga cgccccggcc cggtcatgat ctcgctgccc       480
     gccgacctgc tcgcggaaga gttcaccggg cctgcgccgg cgccgctcgc gcccgtcgcg       540
     cccgccggat gtccccccga gaccgtccgc cggctgcgga gcaccctgga acgggcgcag       600
     cgaccggtgg tcatcgccgg cgcgggcgtt cgccacgcca ccgaccgcct cgtcgcgctc       660
     tgcgaggcct acggtctcgg cgtgtacgcc gcgatgcgac ggcaggacgt cttccccaac       720
     gaccacccgc tctacctcgg ccacctcggt gtctcgcccg cgcccggcac cgtggacgcg       780
     ctccgcgagg ccgacgtggt gctgatcctc ggcgctgcgc tggaccagat gacgacccag       840
     cagttcacgc tgcccgccgc ctcggcgcac cggatccacg tcgacgccga tccgctcacc       900
     ctcggcgccg gcctgcccgt cgacgaggct gtcgtcgccg agccgcgcga gctgatcgag       960
     gcgctgctag ccgaaccgcc caccgcgccg caccgggcct gggacgccgc gcaccgacgg      1020
     ttcctggagt cgacatgcgc ccccccgcgc accccggccc ggggctgcga ccccggtgct      1080
     gtgatcgagg ccatgaagcg cgcgtggccc gccgacacga tcgtcaccag cgacgcgggc      1140
     aacttctcgg gattcctcca ccagtactgg cggttcacga ccccccgcag ccaggccgcg      1200
     cccatcaacg gcgcgatggg ctatgccgtg ccaggcgccg tcggcgccaa ggctgcctcc      1260
     cccgaccggc acgtgctcgg cgtggtcggc gacggtggct tcctgatgac cggcagcgag      1320
     gtcgagaccg ccgtgcgcta cggcctgccg ctgacgatcg tcgtcctgcg caacgggctc      1380
     tacggcacga tcgcgatgca ccaggcccag gagatgggcc gcctgtcggc cgtcgacatc      1440
     ggcgacgtgg acctcgcggc atacggccgc agcctcggcg cggagggcat cacggtcgag      1500
     gagccgggtc agctcgacga ggccatgcgc actgccgcga ccagcgatgc ggtcaccgtc      1560
     gtcgacgtcg tcaccgaccc ggacctcatc accgcgtccg gccggctctc ggagatgttc      1620
     cagacctcct ga                                                          1632
//

If you have problems or comments...

PBIL Back to PBIL home page