(data stored in ACNUC1104 zone)

EMBL: CP000509.PE360

CP000509.PE360       Location/Qualifiers
FT   CDS_pept        392651..393028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO3552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79910"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM5"
FT                   /protein_id="ABL79910.1"
FT                   /translation="MTGRGSGRRRERGAATAELAMALPLLVAITLGLVWLLAVGAAQVR
FT                   AVDAARETARAVARGDSVTAAVARGQRVAPPGSRVSVHDDGGQVTAVVVGRVDGPGGLF
FT                   GRLPGVAVSAQAVAAAEESSP"
     atgaccgggc gcgggagcgg ccgtcgccgc gagcgcgggg ccgcgacggc cgagctcgcg        60
     atggcgctgc cgctcctggt cgcgatcacc ctcggcctgg tgtggctgct cgccgtgggt       120
     gccgcgcagg tccgcgcggt cgacgcggcc cgcgagacgg cccgggcggt cgcccgcggc       180
     gacagcgtga ccgctgcggt ggcgcggggc cagcgggtcg ccccaccggg cagcagggtg       240
     agcgtccacg acgacggcgg ccaggtgacc gccgtcgtcg tgggccgggt cgacggtcca       300
     ggtgggctgt tcgggcggct gcccggggtc gcggtctcgg cgcaggcggt cgccgccgcg       360
     gaggagtcgt cgccgtga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page