(data stored in ACNUC1104 zone)

EMBL: CP000509.PE363

CP000509.PE363       Location/Qualifiers
FT   CDS_pept        complement(393742..396078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0370"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like;
FT                   KEGG: sco:SCO3550 putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79913"
FT                   /db_xref="GOA:A1SDM8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM8"
FT                   /protein_id="ABL79913.1"
FT                   /translation="MRAVLGSQARTAGDLRDVVERLVAAPGREDRLCHLEVLPARAARH
FT                   ADWPAWADPDVVAAFAARGVARPWQHQVVAAEAAHAGQHVVLATGTASGKSLAYQLPAL
FT                   STLRGSRGPRGQRGATVLYLAPTKALAQDQLAGLSGLGLDLRVTTHDGDSSREQRDWAR
FT                   DHGEYVLTNPDMLHRSLLPGHSRWAGFLGALQYVVVDECHHYRGVFGAHVAHVLRRLRR
FT                   VCATYGASPTFVLASATVAEPEAAARRLTGLDVQAVTADHSPRGRVSLLLWEPPFTSFT
FT                   GENGAPVRRAASSETADLLADLVAEDVRTLAFIRSRRGAEQVAMTAAELLTDVDPVLAG
FT                   RVASYRGGYLPEERRAIEDSLRRGEITGLAATNALELGIDISGLDAVVMAGFPGTRAAL
FT                   WQQVGRAGRGAQDALAVLVARDDPLDTYLVTHPEALLGRPVEATVFDPSNPYVLGPHLC
FT                   AAAHEAPLTEADLPLFGPTAREVVDALTEGGLLRRRPRGWFWTDRRRASDLADIRSTGG
FT                   APVQLVEAETGRVIGTVDASSAHGTAHPGAVYVHRGETWLVCSLDLEDRVAVIQRAQPD
FT                   YSTTAREVTEISVVREREHTAWGDCRLSFGEVDVTHQVVSFLKRRQPGGDVLGEEPLDL
FT                   PERSLRTAAVWWTVPDHAVTEAGLSGRDLPGAAHAAEHCSIGLLPLFATCDRWDIGGVS
FT                   TAVHPDTGRLTVFVYDGHPGGAGFAERGFRAAREWLTATRDTIRSCTCEDGCPSCIQSP
FT                   KCGNQNNPLDKAGAAALLDVLLGEA"
     gtgagagcgg tcctcggttc gcaggcgcgc accgccggtg acctccgcga cgtggtcgag        60
     cggctcgtgg ccgcgccggg ccgcgaggac cggctgtgcc acctggaggt gctcccggcg       120
     cgggcggcgc gccacgcgga ctggcccgcc tgggcggacc cggacgtggt cgcggcgttc       180
     gcggcgcgcg gggtcgcgcg cccctggcag caccaggtcg tggccgccga ggcggcgcac       240
     gccggccagc atgtcgtgct cgcgaccggc accgcctccg gcaagagcct ggcctaccag       300
     ctccccgcgc tctcgaccct ccgcggctcc cgggggccgc gcggccagcg cggggccacc       360
     gtgctgtacc tcgcaccgac caaggcgctc gcccaggacc agctggccgg gctgagcggg       420
     ctcgggctcg acctgcgggt caccacccat gacggcgaca gctcacgcga gcagcgcgac       480
     tgggcccgcg accacggcga gtacgtcctc accaaccccg acatgctgca ccgctccctg       540
     ctgcccgggc actcccgctg ggcggggttc ctcggcgccc tgcagtacgt cgtcgtcgac       600
     gagtgccacc actaccgcgg ggtcttcggc gctcacgtcg cccacgtgct ccgacggctg       660
     cggcgggtgt gcgcgacgta cggcgcgagc ccgaccttcg tgctggcctc cgccaccgtc       720
     gcggagcccg aggccgccgc ccggcggctc accggcctcg acgtgcaggc ggtcaccgcc       780
     gaccactctc cgcgcggccg ggtgtcactg ctgctgtggg agccgccctt cacctccttc       840
     accggcgaga acggcgcgcc cgtgcgccgg gccgcctcct ccgagaccgc cgacctgctc       900
     gccgacctgg tggccgagga cgtgcgcacg ctcgcgttca tccgctcccg ccgcggtgcc       960
     gagcaggtcg cgatgaccgc cgccgagctg ctcaccgacg tcgacccggt gctcgcaggc      1020
     cgggtggcgt cctaccgcgg cggctacctg cccgaggagc gtcgggcgat cgaggactcg      1080
     ctgcgtcgcg gcgagatcac cgggctcgcc gcgaccaacg ccctcgagct cggcatcgac      1140
     atcagcggcc tcgacgccgt ggtgatggcc ggcttccccg gcacccgcgc cgccctgtgg      1200
     cagcaggtcg gccgggccgg gcggggcgcc caggacgccc tcgccgtcct cgtcgcccgc      1260
     gacgacccgc tcgacaccta cctcgtcacc caccccgagg cgctgctggg ccgcccggtc      1320
     gaggcgaccg tgttcgaccc gtccaatccc tacgtcctcg gtccgcacct gtgcgcggcc      1380
     gcacacgagg caccgctcac cgaggccgac ctgccgctgt tcggtccgac cgcgcgcgag      1440
     gtcgtcgacg cgctgaccga gggcgggctg ctgcgccgcc gcccgcgcgg ctggttctgg      1500
     accgaccggc gccgggccag cgacctcgcc gacatccggt cgaccggcgg cgctcccgtc      1560
     cagctcgtcg aggcggagac gggccgcgtg atcggcacgg tcgacgcctc gagcgcccac      1620
     ggcaccgccc accccggcgc ggtgtacgtg caccgcggcg agacctggtt ggtgtgctcg      1680
     ctcgacctcg aggaccgcgt ggcggtgatc caacgcgccc agcccgacta ctccacgacc      1740
     gcccgcgagg tcaccgagat ctcggtcgtg cgcgagcgtg agcacaccgc ctggggtgac      1800
     tgccggctgt ccttcggcga ggtcgacgtc acccaccagg tggtgtcctt cctcaagcgg      1860
     cgccaacccg gcggcgacgt gctcggcgag gagccgctcg acctgcccga gcgctcgttg      1920
     cgcacggcgg ccgtgtggtg gacggtgccc gaccacgccg tgaccgaggc gggcctctcc      1980
     ggccgtgacc tgccgggtgc cgcgcacgcc gccgagcact gctcgatcgg tctgctgccg      2040
     ctcttcgcga cctgcgaccg gtgggacatc ggcggagtgt cgacggcggt gcaccccgac      2100
     accgggcgac tgacggtgtt cgtctacgac gggcaccccg gtggcgcggg attcgccgag      2160
     cgcggattcc gagcggcccg ggagtggctg acggcgaccc gggacacgat ccgctcgtgc      2220
     acctgcgagg acggctgccc gtcgtgcatc cagtcgccca agtgtggcaa ccagaacaac      2280
     ccgctcgaca aggcgggcgc cgccgcactc ctcgacgtac tcctcggcga ggcctag         2337
//

If you have problems or comments...

PBIL Back to PBIL home page