(data stored in ACNUC1104 zone)

EMBL: CP000509.PE369

CP000509.PE369       Location/Qualifiers
FT   CDS_pept        complement(403358..404068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79919"
FT                   /db_xref="GOA:A1SDN4"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN4"
FT                   /protein_id="ABL79919.1"
FT                   /translation="MTEQQIKEGYARLGDALAPPLDVTARVQRRVGVRRRRRRVGVVAG
FT                   SLVAVMAAGGGVVAATSGDDGPGDTVAVDQPQGPVSTLVMTRPDGSTYAFSDVAVTCDP
FT                   PQSAGGDTIGATGRIWMYSPMEITGSEEGNDAMVRRPFVYFEGVLAKLRQDRTFEMPVW
FT                   GPGDSDSYPITLFVADTEGGPDGNEAASSSGGSGTVRVLEASCDPTPVLRLEVDATLAS
FT                   EEGKQDLQIAGEVR"
     atgaccgagc agcagatcaa ggagggctac gcgcgcctgg gcgatgcgct ggccccgccg        60
     ttggacgtca ccgcgcgcgt gcagcgccgc gtgggcgtac gccggcggcg gcgtcgcgtg       120
     ggcgtggtgg ccgggagcct ggtggccgtg atggccgcgg ggggcggggt cgtggcggcc       180
     acgtcgggtg acgacggccc cggcgacacc gtggccgtcg accagccgca gggtcccgtg       240
     agcaccctgg tgatgacccg gcccgacggc tcgacgtacg ccttctccga cgtcgccgtg       300
     acgtgcgacc caccgcagtc ggcgggcggc gacacgatcg gcgccaccgg tcgcatctgg       360
     atgtacagcc cgatggagat caccggctcc gaggagggca acgacgccat ggtgcgccgg       420
     ccgttcgtct acttcgaggg tgtcctcgcc aagctgcgtc aggaccgcac cttcgagatg       480
     ccggtctggg gaccgggcga ctccgacagc taccccatca cgctgttcgt cgcggacacc       540
     gagggcggcc ccgacggcaa cgaggctgcg agcagctcgg gcggcagcgg caccgtgcgg       600
     gtgctcgagg cgtcctgcga cccgacgccg gtgctgcgcc tggaggtgga cgcgaccctc       660
     gccagcgagg aggggaagca ggacctgcag atcgccggcg aggtgcgctg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page