(data stored in ACNUC1104 zone)

EMBL: CP000509.PE370

CP000509.PE370       Location/Qualifiers
FT   CDS_pept        complement(404073..404597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0377"
FT                   /product="Sigma-70, region 4 type 2"
FT                   /note="PFAM: regulatory protein, LuxR; sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein; Sigma-70,
FT                   region 4 type 2; KEGG: sma:SAV6340 RNA polymerase
FT                   ECF-subfamily sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79920"
FT                   /db_xref="GOA:A1SDN5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN5"
FT                   /protein_id="ABL79920.1"
FT                   /translation="MEATTDAPSHPDFADFAAVQSGPLLGLAHALTANPHDAWDLTQET
FT                   LARIGERWGRTRIEEPAAYARTVMVRLNIDRIRRLRRELPLLGTPREEAPVEVVGQTDA
FT                   WLVEALATLSPRQRTALALRYVEDLDVRGIAQRMGCSEGTVKSQLSRGTERLREHAREH
FT                   GPLRAAATRED"
     atggaagcca cgacggacgc cccgtcgcac cccgacttcg cggacttcgc ggcggtgcag        60
     agcgggccgc tgctgggcct ggcccacgcc ctgacggcca acccgcacga cgcctgggac       120
     ctgacccagg agacactcgc gcggatcggc gagcggtggg gccggacccg gatcgaggag       180
     ccggcggcgt acgcacggac ggtgatggtg cgcctcaaca tcgaccggat ccggcggctt       240
     cgccgcgagc tcccgctcct ggggacgccg cgggaggagg cgccggtcga ggtggtgggc       300
     cagaccgacg cgtggctggt cgaggcgctc gcgacgctgt cgccgcggca gcgcaccgcg       360
     ttggcgctgc gctacgtcga ggacctcgac gtgcgcggca tcgcccagcg gatgggctgc       420
     tcggaaggca ccgtcaagag ccagctgtcc cgcgggaccg agcggctccg agaacacgca       480
     cgcgagcacg gcccgctgcg cgccgcggcg acacgagagg actga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page