(data stored in ACNUC1104 zone)

EMBL: CP000509.PE371

CP000509.PE371       Location/Qualifiers
FT   CDS_pept        404767..407484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0378"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: sma:SAV4621 putative DNA topoisomerase I;
FT                   TIGRFAM: DNA topoisomerase I; PFAM: TOPRIM domain protein;
FT                   DNA topoisomerase, type IA, central domain protein; SMART:
FT                   DNA topoisomerase I, ATP-binding; DNA topoisomerase I,
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79921"
FT                   /db_xref="GOA:A1SDN6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN6"
FT                   /protein_id="ABL79921.1"
FT                   /translation="MAHKLVIVESPAKARTIGGYLGQGYVVESSIGHIRDLPQSAADTP
FT                   AKIKDKPWGRLAVDVDNGFEPYYVVPRDKKSHIAKLKTLLKEADELYLATDEDREGEAI
FT                   AWHLLDELKPKDIPVKRMVFHEITKPAIIAAAEHPRELDMDLVEAQEARRILDRLYGYE
FT                   VSPVLWKKVMSGLSAGRVQSVATRLVVDRERERMAFRVASYWDLEGTFDAGATKEPRMF
FT                   PAKVHSVDGSRVAGGSDFGPDGLLKAKKGERVHLDRAAAEALVAALAETTYDVRSVEAK
FT                   PYRRSPYAPFRTTTLQQEASRKLGMSASVTMSVAQRLYENGFITYMRTDSTTLSGGAVE
FT                   AARAQVRELYGAEYLPDTPRTYTSKVKNAQEAHEAIRPAGDSFRTPAQTGLTGDQFRLY
FT                   ELIWMRTVASQMKDATGQSVSVRIGGVAADGRDVVFAASGRVITFHGFLKAYVEGTEGG
FT                   KRSDDDQVPLPDLHEGDAVSAASLAANGHETKPPARYTEATLIKELEDREIGRPSTYAS
FT                   IIGTILNRGYVYKKGTALVPAWLAFSVTRLLEEHFPRQVSYEFTAGMEDVLDEIAGGRK
FT                   DLKSELSEFYYGSDSVVGLKPLVDGLGEIDARELATFPIGGADAGINLRVGRYGPYLEG
FT                   PDDDGTAYARRANVPDDLPPDELTLDKAKELLANPAGEEIRLGVHPDTGLEVVAKNGRF
FT                   GPYVTEVLPEDAAQGRKKGAAKPRTGSLFKSMSLDTVTLADAVKLLSLPRVVGVAEDGE
FT                   EVTAQNGRYGPYLKKGTDSRSLASEDQLLTITLDEALRIYAQPKQRGRAAAAAPLKELG
FT                   NDPVSGQPVVVKAGRFGEYVTDGEYNATLRKEDSVESITIERAAELLAERRAKGPAKKA
FT                   AKRGAKKAPAKKAAAKKTATKKAATKKATAKKAT"
     gtggcccaca agttggtcat cgtcgagtcg ccggcgaagg cccgcacgat cggcgggtac        60
     ctcggccagg ggtacgtcgt cgagtcctcc atcggccaca tccgcgacct cccgcagagc       120
     gccgccgaca cccccgcgaa gatcaaggac aagccgtggg gccggctcgc ggtcgacgtc       180
     gacaacggct tcgagccgta ctacgtggtg ccccgtgaca agaagtcgca catcgccaag       240
     ctgaagaccc tcctcaagga ggcggacgag ctctacctcg ccaccgatga ggaccgcgag       300
     ggcgaggcga tcgcctggca cctgctcgac gagctcaagc ccaaggacat ccccgtcaag       360
     cggatggtct tccacgagat caccaagccg gcgatcatcg ccgccgcgga gcacccgcgc       420
     gagctcgaca tggacctggt ggaggcccag gaggcgcgtc gcatcctcga ccggctctac       480
     ggctacgagg tcagcccggt gctctggaag aaggtcatgt ccggcctctc cgcgggccgg       540
     gtgcagtccg tcgcgacccg cctggtcgtg gaccgcgagc gggagcggat ggcgttccgc       600
     gtcgcgtcgt actgggacct cgagggcacc ttcgacgccg gggcgaccaa ggagccccgg       660
     atgttcccgg ccaaggtcca ctccgtcgac ggcagccggg tcgccggtgg ctccgacttc       720
     ggcccggacg gcctgctcaa ggccaagaag ggcgagcgcg tccacctgga ccgcgccgct       780
     gccgaggcgc tggtcgcggc actcgccgag acgacgtacg acgtccgctc ggtcgaggcc       840
     aagccgtacc ggcgctcgcc gtacgccccg ttccgcacca ccacgctgca gcaggaggcc       900
     agccgcaagc tcggcatgag cgcgtcggtg acgatgtcgg tcgcgcagcg gctctacgag       960
     aacggcttca tcacctacat gcgcaccgac tcgaccacgc tctcgggcgg cgcggtcgag      1020
     gcggctcgcg cgcaggtgcg tgagctgtac ggcgcggagt acctgcccga cacgccgcgg      1080
     acctacacga gcaaggtgaa gaacgcccag gaggcgcacg aggcgatccg cccggccggc      1140
     gactcgttcc gcacgccggc gcagaccggc ctgaccggtg accagttccg cctctacgag      1200
     ctgatctgga tgcgcaccgt cgcctcgcag atgaaggacg cgaccggcca gtccgtctcg      1260
     gtccggatcg gcggcgtggc cgccgacggc cgcgacgtcg tgttcgccgc gtccggccgg      1320
     gtgatcacct tccacgggtt cctgaaggcg tacgtcgagg gcaccgaggg cggcaagcgc      1380
     agcgacgacg accaggtgcc gctgcccgac ctccacgagg gtgacgccgt ctcggccgcc      1440
     tcgctggccg ccaacggcca cgagaccaaa ccgccggcgc gctacaccga ggcgacgctg      1500
     atcaaggagc tcgaggaccg cgagatcggc cggccgtcga cgtacgcctc gatcatcggc      1560
     accatcctca accgcggcta cgtctacaag aagggcaccg cgctggtgcc cgcgtggctc      1620
     gcgttctcgg tgacccggct gctcgaggag cacttcccgc ggcaggtctc ctacgagttc      1680
     accgcgggca tggaggacgt cctcgacgag atcgcgggcg gccgcaagga cctgaagtcc      1740
     gagctgagcg agttctacta cggctcggac agcgtggtcg ggctcaagcc gctggtcgac      1800
     gggctgggcg agatcgacgc gcgcgagctc gcgacgttcc cgatcggggg agcggacgcc      1860
     ggcatcaacc tccgggtcgg ccgctacggt ccctacctgg agggccccga cgacgacggg      1920
     acggcgtacg cccggcgggc caacgtgccc gacgacctcc cgcccgacga gctcacgctc      1980
     gacaaggcca aggagctgct ggcgaacccg gccggcgagg agatccggct gggcgtgcac      2040
     cccgacaccg ggctcgaggt ggtcgcgaag aacggccggt tcggcccgta cgtgaccgag      2100
     gtgctcccag aggacgccgc gcagggtcgg aagaaggggg cggccaagcc gcgcaccggc      2160
     tcgctgttca agtcgatgtc gctggacacg gtcacgctcg cggacgcggt caagctgctc      2220
     tccctgcccc gcgtggtcgg cgtggccgag gacggcgagg aggtcaccgc ccagaacggc      2280
     cgctacgggc cgtacctgaa gaagggcacc gactcccggt cgctggcctc cgaggaccag      2340
     ctgctgacga tcaccctcga cgaggcgctg cggatctacg cccagcccaa gcagcggggc      2400
     cgggccgcgg ccgccgcgcc gctcaaggag ctcggcaacg acccggtctc gggccagccc      2460
     gtggtcgtga aggccggccg gttcggcgag tacgtcaccg acggcgagta caacgccacc      2520
     ctccgcaagg aggactccgt cgagtcgatc accatcgagc gcgccgcgga gctgctggcg      2580
     gagcgccggg ccaagggccc ggcgaagaag gcggccaaga ggggtgcgaa gaaggcgccg      2640
     gccaagaagg cggcggccaa gaagaccgct accaagaagg cggccacgaa gaaggcgacc      2700
     gccaagaagg cgacgtag                                                    2718
//

If you have problems or comments...

PBIL Back to PBIL home page