(data stored in SCRATCH zone)

EMBL: CP000509.PE372

CP000509.PE372       Location/Qualifiers
FT   CDS_pept        407542..408570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0379"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: sco:SCO6349
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79922"
FT                   /db_xref="GOA:A1SDN7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN7"
FT                   /protein_id="ABL79922.1"
FT                   /translation="MPAHRDKRHPTMADVAARAGVSHQTVSRVINNAPSVRPETAARVV
FT                   QAISDLGYRPNRSARLLASRHSRLIGVATWGTSHHGPQQVLLALDAAARRADYRTAVST
FT                   LHALTEQDTRDGVEELLQLGVEAVVLIIPHESMLRFATEADLGVPTVVVEGDLSRMPLT
FT                   VGVDNVQGGSLATRHLLELGHRTVVHVAGPPGWAEAAARVDGWRLELETWGRVVPPLRW
FT                   GGDWSARSGYDAGVSLARDPEVTAVFAANDQMAMGVIAALREAGRRVPDDISVVGFDDL
FT                   PESAYLDPPLTSVHQDFGELGRRAMGLLERVLAGEKKPTADLVPTSLVVRASTSSPRVP
FT                   AN"
     atgccggccc accgcgacaa gcgccatccc acgatggccg acgtggcggc ccgggccggg        60
     gtctcccacc agacggtgtc acgggtgatc aacaacgcgc cgagcgtccg gccggagacg       120
     gcagcccggg tggtccaggc gatcagcgac ctcggctacc gccccaaccg ctcggcgcgg       180
     ctcctcgcct cgcggcactc ccggctgatc ggcgtcgcga cctggggcac cagccaccac       240
     gggccgcagc aggtgctgct cgcgctggac gcggccgccc gccgcgccga ctaccggacc       300
     gccgtcagca ccctgcacgc gctgaccgag caggacaccc gggacggcgt cgaggagctg       360
     ctccagctcg gggtcgaggc ggtggtgctg atcatcccgc acgagtcgat gctgcggttc       420
     gcgaccgagg ccgacctcgg ggtgccgacc gtggtcgtcg agggggacct ctcgcggatg       480
     ccactgaccg tcggggtcga caacgtccag ggcggcagcc tcgcgacccg gcacctgctc       540
     gagctgggcc accgcaccgt cgtgcacgtc gccggcccgc cgggctgggc cgaggcggcc       600
     gcccgcgtcg acgggtggcg gctggagctc gagacctggg gccgggtggt gccgcccctg       660
     cggtggggcg gcgactggag tgcccgcagc gggtacgacg ccggcgtctc cctggcgcgc       720
     gatcccgagg tcaccgcggt gttcgccgcg aacgaccaga tggcgatggg ggtgatcgcc       780
     gcgttgaggg aggccggccg ccgggtgccc gacgacatct cggtcgtcgg gttcgacgac       840
     ctgccggagt cggcgtacct cgatccgccg ctgacctcgg tgcaccagga cttcggggag       900
     ctggggcgcc gcgccatggg gctcctcgag cgggtgctgg ccggcgagaa gaagccgacc       960
     gccgacctgg tgccgacctc gctggtcgtc cgggcgtcca cctcgtcgcc gcgggtgccc      1020
     gcgaactga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page