(data stored in ACNUC1104 zone)

EMBL: CP000509.PE374

CP000509.PE374       Location/Qualifiers
FT   CDS_pept        410564..411280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0381"
FT                   /product="L-ribulose 5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: blo:BL0273 L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79924"
FT                   /db_xref="GOA:A1SDN9"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN9"
FT                   /protein_id="ABL79924.1"
FT                   /translation="MNAVVSAESREAVRRLQAEVAALHAELTRNRLVVWTAGNVSARVP
FT                   GTDLFVIKPSGVSYDELDADTMVVCDLDGTLVEGARQPSSDTAAHAYVYRHLPEVGGVV
FT                   HTHSTYATAWAARGEPIPCVLTMAADEFGGEIPIGPFALIGDDSIGRGIVETLRESRSR
FT                   AVLMQNHGPFTVGPDARSAVKAAVMVEDVARTVHVARQLGAPLPIAQEHVDALYDRYQN
FT                   VYGQTQQTQQQTGGVA"
     atgaacgccg tcgtcagcgc cgagtcccgc gaggcggtac gccggctgca ggcggaggtc        60
     gccgcgctgc acgccgagct gacccgcaac cggctggtcg tgtggaccgc cggcaacgtg       120
     tccgcgcggg tgccgggcac cgacctgttc gtgatcaagc cgtcgggggt ctcctacgac       180
     gagctggacg ccgacacgat ggtcgtctgc gacctcgacg gcaccctggt cgagggggcg       240
     cgacagccga gctccgacac cgccgcccac gcctacgtct accgccacct gcccgaggtc       300
     ggcggggtcg tgcacaccca ctcgacgtac gcgaccgcgt gggccgcccg cggcgagccg       360
     atcccgtgcg tgctcacgat ggcggccgac gagttcggcg gcgagatccc gatcgggccg       420
     ttcgcgctga tcggggacga ctcgatcggc cgcgggatcg tcgagacgct gcgcgagagc       480
     cgctcgcgcg ccgtactcat gcagaaccac ggcccgttca ccgtcgggcc cgatgcccgg       540
     tccgccgtca aggcggccgt gatggtcgag gacgtcgctc gcacggtgca cgtcgcccgc       600
     cagctcggtg cgccgctccc gatcgcccag gagcacgtcg acgccctcta cgaccgctac       660
     cagaacgtgt acggccagac ccagcagacc cagcaacaga ccggaggagt cgcgtga          717
//

If you have problems or comments...

PBIL Back to PBIL home page