(data stored in ACNUC1104 zone)

EMBL: CP000509.PE377

CP000509.PE377       Location/Qualifiers
FT   CDS_pept        414015..415544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0384"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: lxx:Lxx00320 multiple sugar (arabinose, xylose,
FT                   galactose, glucose, fucose) putative porter; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79927"
FT                   /db_xref="GOA:A1SDP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDP2"
FT                   /protein_id="ABL79927.1"
FT                   /translation="MAQPILEMRSITKRFPGVLALSDVNLAVERGEIHAICGENGAGKS
FT                   TLMKVLSGVHPHGTYEGEIVYEGQPVEFSNIRQSEAAGIVIIHQELALIPELSIAENIF
FT                   LGNETATRGVINWDEANSRAIELMARVGLRENPLTAVKNLGIGKQQLVEIAKALSKEVR
FT                   LLILDEPTAALNDEDSNHLLDLLKGLQGKGITSIMISHKLNEIARISDSITILRDGKTI
FT                   ETLNVGAGGVDEDRIIRGMVGRSLEHRFPDHTPQIGGVLLEVRDWTVMHPLDHSRVVID
FT                   KASLSVRRGEIVGIAGLMGAGRTELARSLFGRSYGSKHHGTVHLDGKELRLKTVHDAIR
FT                   AGIAYVSEDRKGLGLNLLDDVKTSISSAGLDQLRKGLTVDEREEVLVAERYRRSFGIKA
FT                   PSVTTGVRQLSGGNQQKVVLGKWLYTEPQLLILDEPTRGIDVGAKFEIYGIIQTLAREG
FT                   KGVLVISSELPELLGLCDRIYTLAEGVITHEFVRGGATQESLMRYMTADAR"
     atggcccagc cgatcctgga gatgcgctcc atcaccaagc gcttccccgg cgtgctggcg        60
     ctgtcggacg tcaacctcgc cgtcgagcgt ggcgagatcc acgccatctg cggtgagaac       120
     ggcgccggca agtcgacgct gatgaaggtg ctgagcgggg tccacccgca cgggacctac       180
     gagggcgaga tcgtctacga ggggcagccg gtcgagttct cgaacatccg gcagagcgag       240
     gcggccggca tcgtcatcat ccaccaggag ctggcgctga tccccgagct ctcgatcgcc       300
     gagaacatct tcctcggcaa cgagaccgcg acccggggcg tcatcaactg ggacgaggcg       360
     aacagccggg cgatcgagct gatggctcgc gtcggtctcc gcgagaaccc cctgaccgcg       420
     gtcaagaacc tcggcatcgg caagcagcag ctggtcgaga tcgccaaggc gctgagcaag       480
     gaggtgcggc tcctcatcct cgacgagccg accgccgcgc tcaacgacga ggactccaac       540
     cacctgctcg acctgctcaa gggcctgcag ggcaagggca tcacctcgat catgatcagc       600
     cacaagctga acgagatcgc ccggatctcc gactcgatca cgatcctgcg cgacggcaag       660
     accatcgaga cgctgaacgt gggtgccggt ggcgtcgacg aggaccggat catccgcggg       720
     atggtcggcc gcagcctgga gcaccggttc ccggaccaca cgccgcagat cggcggcgtg       780
     ctgctcgagg tgcgggactg gaccgtcatg cacccgctgg accacagccg ggtcgtcatc       840
     gacaaggcga gcctctcggt ccggcgtggt gagatcgtcg ggatcgcggg cctgatgggc       900
     gccggccgca ccgagctggc ccgcagcctc ttcggccgct cctacggcag caagcaccac       960
     gggaccgtgc acctcgacgg caaggagctg cggctcaaga cggtgcacga cgcgatcagg      1020
     gccggcatcg cctacgtcag cgaggaccgc aagggcctcg ggctcaatct cctcgacgac      1080
     gtcaagacct cgatctcctc ggccggcctc gaccagctgc gcaagggcct gacggtcgac      1140
     gagcgcgagg aggtgctggt cgccgagcgc taccggcgca gcttcgggat caaggcgccc      1200
     tcggtgacca ccggggtgcg ccagctctcc ggcggcaacc agcagaaggt cgtcctgggc      1260
     aagtggctct acaccgagcc ccagctgctg atcctcgacg agcccacgcg tggcatcgac      1320
     gtcggcgcca agttcgagat ctacgggatc atccagaccc tcgctcgcga gggcaagggc      1380
     gtgctggtga tctcctcgga gctgcccgag ctgctcggcc tgtgcgaccg gatctacacg      1440
     ctcgcggagg gcgtgatcac ccacgagttc gtgcgtgggg gcgccaccca ggagtccctc      1500
     atgcgttaca tgacagcgga tgcgagataa                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page