(data stored in SCRATCH zone)

EMBL: CP000509.PE380

CP000509.PE380       Location/Qualifiers
FT   CDS_pept        417907..419064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0387"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: pac:PPA0244 DNA polymerase III delta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79930"
FT                   /db_xref="GOA:A1SDP5"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDP5"
FT                   /protein_id="ABL79930.1"
FT                   /translation="MTVWDGLVGQHRPSEALRAAAHGQGMSHAFLFTGPPGSGRSNAAV
FT                   AFAAALQCERPEDRGCGECHECHTVLTGSHADVAVIRTEKLSIGVDEMRDLVRRSALAP
FT                   VGRRWQIMIVEDADRLTERAWNALLKAIEEPADRTVWMLCAPTVEDVLPTVRSRCRLVT
FT                   LTTPTTDDVASFLVRADGVDAAVASYAARASQGHIGRARALARDEATRNRRREVVALPA
FT                   RLVSLRACMEAATSLAEVAKQEAELVTGELDAREKADLDAAYGVVERGRRPREYAPALR
FT                   DLEKDQKTRAKRRYLDVVDRGLMDLVSVYRDAIAVATGAAGLLVNEEIRGDVELLARVS
FT                   TPEVNLRRIAAIFEAREQMLEFNVQPMLALESMMVALVAPEVRTG"
     atgaccgtct gggacggcct cgtcgggcag catcggccga gcgaggcgct gcgcgcggcc        60
     gcccacgggc agggcatgag ccacgccttc ctcttcaccg gcccgcccgg ctcgggtcgg       120
     tccaacgcgg ccgtcgcctt cgcggcggcg ctgcagtgcg aacgccccga ggaccgcggg       180
     tgcggcgagt gccacgagtg ccacacggtg ctgaccggca gccacgccga cgtggcggtg       240
     atccgcaccg agaagctctc catcggggtc gacgagatgc gcgacctggt gcgccgctcg       300
     gccctcgccc cggtcggccg gcgctggcag atcatgatcg tcgaggacgc cgaccggctc       360
     accgagcggg cgtggaacgc gctgctcaag gcgatcgagg agcccgcgga ccgcaccgtg       420
     tggatgctgt gcgctcccac ggtcgaggac gtgctgccca cggtccggtc gcgctgccgg       480
     ctggtcacgc tcacgacccc gacgaccgac gacgtcgcct cgttcctggt ccgtgcggac       540
     ggggtcgacg ccgcggtggc gtcgtacgcc gcccgcgcga gccagggcca catcggccgc       600
     gcccgggcgc tggcccgcga cgaggcgacc cgcaaccggc gccgcgaggt ggtcgcgctg       660
     cccgcccggc tggtctcgct gcgcgcctgc atggaggccg ccaccagcct cgccgaggtc       720
     gccaagcagg aggccgagct ggtgaccggc gagctggacg cgcgcgagaa ggccgacctg       780
     gacgcggcgt acggcgtggt cgagcgcggc cgccgcccgc gggagtacgc acccgcgctg       840
     cgcgacctcg agaaggacca gaagacccgc gccaagcggc gctacctcga cgtcgtcgac       900
     cggggcctga tggacctggt gtcggtctac cgcgacgcga tcgcggtcgc gaccggcgcc       960
     gccggcctcc tggtcaacga ggagatccgc ggcgacgtcg agctgctcgc ccgggtgtcg      1020
     acccccgagg tcaacctgcg ccggatcgcg gcgatcttcg aggcccgcga gcagatgctg      1080
     gagttcaacg tgcagccgat gctggcgctg gagtcgatga tggtcgcgct cgtcgcgccg      1140
     gaggtgcgca ccgggtga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page