(data stored in ACNUC1104 zone)

EMBL: CP000509.PE385

CP000509.PE385       Location/Qualifiers
FT   CDS_pept        complement(423752..424702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0392"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: csa:Csal_1417 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79935"
FT                   /db_xref="GOA:A1SDQ0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ0"
FT                   /protein_id="ABL79935.1"
FT                   /translation="MLSLHQLTCFLATYEHGSLTAAAEELGYAQPSVSEQIRALEKTLG
FT                   VQLFRRVGRGVVPTTVADTLRPHAEKVLATVDEAAQAVQSVKSLETGTIRFGMFGIARL
FT                   YAGAGLIGDVLSRYPGVRVELVGQNSTEVAEDLRRGRLEAAMLAVSGIQSEGMTVTPVA
FT                   REELVYISADPTRLATPVTPHRLSQASLVMSETTYRAVDSTRATLRQMLHETGHNPATR
FT                   IEVEDIETAVELVGMGYADSVVPKGAALQLLPRLAPEAGWVALRPRQYDTFAVVHRTGA
FT                   ILSPAARLMIDLATARIQAIAEPVTARAARATVGA"
     atgctttcgt tacatcagct cacgtgcttc ctcgcgacct acgagcacgg ctcgctgacg        60
     gcggcggccg aggagctcgg ctacgcccag ccgtcggtct ccgagcagat ccgggccctg       120
     gagaagacgc tcggcgtgca gctcttccgc cgggtcggcc ggggcgtggt ccccacgacg       180
     gtcgccgaca cgcttcggcc gcacgccgag aaggtgctcg cgacggtcga cgaggcggcg       240
     caggccgtgc agagcgtgaa gtcgctcgag accggcacga tccgcttcgg catgttcggg       300
     atcgcgcggt tgtacgccgg agcggggctg atcggcgacg tgctctcgcg ctacccgggc       360
     gtgcgcgtcg agctggtcgg ccagaactcc accgaggtcg cggaggacct gcgccgcggc       420
     cgcctggagg ccgcgatgct cgcggtctca ggcatccaga gcgaggggat gacggtcacc       480
     ccggtggcgc gcgaggagct cgtgtacatc agcgccgacc ccacccgcct ggccacgccc       540
     gtcacccccc accggctctc ccaggcgtcc ctggtgatgt cggagacgac gtaccgcgcc       600
     gtcgactcga cccgcgccac gctgcggcag atgctccacg agaccgggca caatcccgcc       660
     acccggatcg aggtcgagga catcgagacg gccgtggagc tggtggggat ggggtacgcc       720
     gactcggtgg tcccgaaggg cgccgcgctc cagctgctcc cccgcctggc gccggaggcg       780
     ggctgggtgg cgctgcggcc gcggcagtac gacaccttcg ccgtggtcca ccgcaccggc       840
     gccatcctct cccccgccgc ccggttgatg atcgacctcg ccaccgcacg gatccaggcg       900
     atcgccgagc cggtgacggc tcgcgcggcg cgggctaccg tcggagcatg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page