(data stored in ACNUC1104 zone)

EMBL: CP000509.PE387

CP000509.PE387       Location/Qualifiers
FT   CDS_pept        425549..426130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79937"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ2"
FT                   /protein_id="ABL79937.1"
FT                   /translation="MEKQSFGLISASGGKGGREGKAARSGAKSGRSTTTVDKSAQFRLR
FT                   SATKGERRVSSSALRRDTRPTLDLLQDTDAVAVTHYNEVEGYLVAPDRYLGLVARVEEA
FT                   DERESELASTMTVLLAAARTGVAVPSEMLERVMPRVDVAERWREIAEFAATFPTRITAG
FT                   EHGEPITRAHLSHVGGPIEEFGSDDDLNLG"
     atggagaagc agtcgttcgg gctgatcagc gcctccggag gcaagggcgg cagggaaggc        60
     aaggccgcgc gttctggagc caagagcggc aggtctacga ccacggtcga caagtccgcc       120
     cagttccgtc tgcgctccgc caccaagggc gagcggcgcg tgtcatcgag tgcacttcgc       180
     cgcgacaccc gaccgacgct ggacctcctc caagacaccg acgcagtcgc ggtcacgcac       240
     tacaacgagg tcgaaggcta tctggtcgcg cccgaccgtt atctcgggct ggtcgcccgc       300
     gtcgaggagg cagatgagcg cgagagcgaa ctcgcctcga ccatgaccgt gctgctcgcc       360
     gctgcgcgca ccggcgttgc ggtcccgtca gagatgctcg aacgagtcat gccccgcgtc       420
     gatgtggctg agcggtggcg cgaaatcgcc gagttcgcgg ccacattccc gacccggatc       480
     actgccggtg agcacggcga acccatcacg cgtgcacacc tctcgcacgt gggcggaccg       540
     atcgaagagt tcggttcgga tgacgacctc aacctcggct ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page