(data stored in ACNUC1104 zone)

EMBL: CP000509.PE388

CP000509.PE388       Location/Qualifiers
FT   CDS_pept        426148..426810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79938"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ3"
FT                   /protein_id="ABL79938.1"
FT                   /translation="MAEETQGSASDAWYPAPAGYWVPAEEADRPDVWPHRFGDLFRAPP
FT                   SDANGTPLTTSDGRPWDAVMVYSPSCEVISKAKQSDSVEVVRVVRLDTQDPKAAAAIIG
FT                   GWQERQGRIGVAYAHTVFLAAVAGHPTHDYPMFAHLKSTVRVALGDLRAAGRIAALTHD
FT                   ARIAVIRRDLYYRYRWLVPIEEVKAAEIDRISNDPHFTPPRPGWAPDASEENAETHG"
     gtggcggagg aaacgcaggg cagcgccagc gatgcctggt acccggcgcc tgcgggctat        60
     tgggttccag cggaggaggc ggaccggccc gacgtctggc cacaccgttt cggcgacctc       120
     ttccgcgctc cgccgagcga cgccaacggc acgcccttga cgacaagcga cgggcgaccg       180
     tgggacgcgg tcatggtcta ctcgcccagt tgcgaggtca tctcgaaggc gaagcagagc       240
     gacagcgtcg aggtcgtgcg ggtcgtccgt ctcgacaccc aagacccgaa agccgccgcc       300
     gcgatcatcg gtggctggca ggaacgacag ggccggatcg gagtcgcgta cgcacacacg       360
     gtgtttctcg ccgccgtcgc cggccacccc actcacgact atccgatgtt cgcccacctc       420
     aagtccaccg tgcgcgtcgc cctcggcgat ctacgtgcgg cagggcgcat cgcggcgttg       480
     acccacgacg ctcggatcgc cgtgatccga cgcgacctgt actaccggta ccgatggttg       540
     gttcccatcg aggaggtgaa ggccgccgag atcgaccgga tctccaacga tccgcacttc       600
     acgccgccgc gccccgggtg ggcacccgac gcctcggaag agaacgccga gacgcacggc       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page