(data stored in ACNUC1104 zone)

EMBL: CP000509.PE39

CP000509.PE39        Location/Qualifiers
FT   CDS_pept        43915..45135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0039"
FT                   /product="Formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: mes:Meso_2971 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79589"
FT                   /db_xref="GOA:A1SCQ4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCQ4"
FT                   /protein_id="ABL79589.1"
FT                   /translation="MDERPGELLPLSGVRVVDLTRALSGPFCTMLLGDQGAEVVKIERP
FT                   VVGDDTRRQSNPMVGTENSAFLAVNRNKRSVAVDLRAEAGVEVVRRLVAVSDVVVENFR
FT                   PGKAEQMGLGYEQLRELNPGLVYCSISGWGSDGPYAARGGYASTAEAAGGLMSVTGERG
FT                   RGPVKVGVSIVDSLTGLYAKDAITAALLARVRTGVGQKVETSLLESTVSILSMSAYAYL
FT                   LGGVVAGRWGSEHQWHVPWKAFPTVDGFLVIATNNQEQWRKICVGIERPDLLEDPRFTT
FT                   MADRAAHREILYALLDEVFATRTTHDWVARLDAVGAAAAPVNTIDQVFADPQVLARDML
FT                   QSVEHPTLGPIAQVGHAQKLHGTPHQITLPPPLLGQHTREVLTDLGGYTPDEIDELISG
FT                   RVIPANC"
     atggacgagc gtccggggga gctgctgccg ttgtcggggg tgcgggtggt ggacctgacc        60
     cgggcgttgt cgggtccgtt ctgcacgatg ctgctgggcg accagggcgc cgaggtggtc       120
     aagatcgagc ggccggtggt cggggacgac acccggcgcc agtccaaccc gatggtgggt       180
     acggagaact ccgcgttctt ggcggtcaac cgcaacaagc gcagcgtggc ggtcgacctg       240
     cgcgccgagg cgggggtcga ggtggtgcgg cggctggtcg cggtcagcga cgtggtcgtg       300
     gagaacttcc ggcccggcaa ggccgagcag atggggctgg gctacgagca gctgcgcgag       360
     ctcaacccgg ggctggtcta ctgctcgatc tcggggtggg gcagcgacgg gccctacgcc       420
     gcgcggggtg ggtacgcctc gaccgccgag gccgccggcg ggctgatgag cgtcaccggc       480
     gagcgcggcc ggggcccggt caaggtcggg gtctccatcg tggactccct gaccggcctg       540
     tacgccaagg acgccatcac cgccgccctc ctggcccgcg tccgcaccgg cgtgggccag       600
     aaggtcgaga cctcactgct ggagtcgacc gtctccatcc tgtcgatgtc ggcctacgcc       660
     tacctcctcg gcggcgtcgt cgccggccgc tggggctccg agcaccagtg gcacgtcccc       720
     tggaaggcct tccccaccgt cgacgggttc ctggtcatcg ccaccaacaa ccaggagcag       780
     tggcgcaaga tctgcgtggg catcgagcgg cccgacctgc tcgaggaccc ccggttcacc       840
     accatggccg accgcgccgc gcaccgcgag atcctctacg ccctcctcga cgaggtcttc       900
     gccacccgca ccacccacga ctgggtcgcg cgcctggacg ccgtcggcgc cgccgccgcc       960
     cccgtcaaca ccatcgacca ggtcttcgcc gacccccagg tcctggcccg cgacatgctc      1020
     cagagcgtcg aacaccccac cctgggcccg atcgcccagg tcggccacgc ccagaagctc      1080
     cacggcaccc cccaccagat caccctcccc ccgcccctgc tcggccagca cacccgcgag      1140
     gtcctcaccg acctcggcgg ctacaccccc gacgagatcg acgagctcat cagcggtcga      1200
     gtaattcctg caaactgttg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page