(data stored in ACNUC1104 zone)

EMBL: CP000509.PE390

CP000509.PE390       Location/Qualifiers
FT   CDS_pept        427653..428579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0397"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro05190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79940"
FT                   /db_xref="GOA:A1SDQ5"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ5"
FT                   /protein_id="ABL79940.1"
FT                   /translation="MRKILPALLIVVGTFFLVVAIVALTWVPGQVERTPLDTDNVTDLS
FT                   GTAGVFSGGDALDEGPVKAWSTNAVDSEASDDDNVVFNTSLCLVHDEGGIDGCVDADDP
FT                   QGRLISAETTLFVTDRHTAMTVDNDGYLPETAPQLEGLQNKWPFDAQKKAYPVWDDIIA
FT                   GTVEAEYLGEDEIDGLKVYKYEYHATADSVVVAGDITGTYDATYTFYIEPRTGSIIKQV
FT                   VHQERVADNGTPLLELDLAFTDEQVQKNVDDANEAISTLRLLEDIVPIVGLAAGIPLIL
FT                   LGLALLLLARRRRTAAPADQPKATAGA"
     atgcgcaaga tcctgcccgc tctgctcatc gtggtgggca ccttcttcct ggtggtggcg        60
     atcgtcgccc tcacctgggt gcccggacag gtcgagcgga cgccgctcga caccgacaac       120
     gtcaccgacc tgtccggcac ggccggcgtg ttctccggcg gagacgccct cgacgagggg       180
     ccggtcaagg cgtggagcac caatgccgtc gactccgagg cgtccgacga cgacaacgtg       240
     gtgttcaaca cctcgctgtg cctggtgcac gacgagggcg gcatcgacgg ctgcgtcgac       300
     gcggacgacc cccagggccg gctgatcagc gccgaaacga ccctgttcgt caccgatcgg       360
     cacaccgcga tgacggtgga caacgacggg tacctgcccg agaccgcccc gcagctcgag       420
     ggcctgcaga acaagtggcc gttcgacgcc cagaagaagg cctacccggt ctgggacgac       480
     atcatcgccg gcaccgtcga ggcggagtac ctgggcgagg acgagatcga cggcctgaag       540
     gtctacaagt acgagtacca cgccaccgcc gattcggtcg tggtggccgg cgacatcacc       600
     ggcacgtacg acgcgacgta cacgttctac atcgagccgc ggaccggttc gatcatcaag       660
     caggtcgtcc accaggagcg ggtcgccgac aacgggacgc cgctgctgga gctcgacctg       720
     gcattcaccg acgagcaggt ccagaagaac gtcgacgacg ccaacgaagc gatctcgacg       780
     ctgcgcctgc tcgaggacat cgtcccgatc gtcggactcg ccgccgggat ccccctcatc       840
     ctgctcgggc tggcgctgct gctcctcgcc cgccgccggc gcacggcggc tcccgcggac       900
     cagccgaagg ccacggccgg ggcctga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page