(data stored in ACNUC1104 zone)

EMBL: CP000509.PE392

CP000509.PE392       Location/Qualifiers
FT   CDS_pept        complement(429287..430168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0399"
FT                   /product="deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   cch:Cag_1641 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79942"
FT                   /db_xref="GOA:A1SDQ7"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ7"
FT                   /protein_id="ABL79942.1"
FT                   /translation="MADLEGNLAAKDFGLDRPQQVEGFHIKGASQLDFGMRHRLSRIFG
FT                   ADGRTVMLAFDHGYFQGPTSGLERVDLNIVPLAPYADALMATRGIIRSVIPASCDNALV
FT                   VRASGGPSILNDLSDERIAMDITDAVRMDAAAVAVQVFIGSDHETQSIHNLTQLVDAGL
FT                   GAGVPVLGVTAVGRDMVRDARYLGLATRIIAELGAQLVKTYYCEDFAQVTAACPVPIIM
FT                   AGGKKLPVLDALNMARKAVDEGAAGVDMGRNIFQRRDPHAMLQAVRSVVHDEWSPEKAA
FT                   ELYRDLSHGAED"
     atggctgacc tcgagggcaa cctcgccgcc aaggacttcg gcctcgaccg cccccagcag        60
     gtggagggat tccacatcaa gggcgccagc cagctcgact tcggcatgcg ccaccgcctc       120
     tcgcgcatct tcggcgccga cggacgcacc gtcatgctcg ccttcgacca cgggtacttc       180
     caaggtccca ccagcgggct cgagcgtgtc gacctgaaca tcgtgccgct cgcgccgtac       240
     gcggacgcgc tcatggccac gcgaggcatc atccgctcgg tcatcccggc cagctgcgac       300
     aacgctctcg tcgtccgggc gtccggcggc ccctccatcc tcaacgacct gtccgacgag       360
     cgcatcgcga tggacatcac cgacgccgtg cgcatggatg ccgcggccgt ggcggtccag       420
     gtgttcatcg gcagcgacca cgagacccaa tccatccaca acctgaccca gctcgtcgac       480
     gctgggctgg gggcgggcgt ccccgtcctc ggcgtgaccg cggtcggccg ggacatggtg       540
     cgagacgcgc gctacctcgg cctcgccacc cggatcatcg cggagctcgg cgcccagctc       600
     gtcaagacgt actactgcga ggacttcgca caggtcaccg ctgcgtgccc ggtaccgatc       660
     atcatggccg gtggcaagaa gctgcccgtg ctcgacgcct tgaacatggc gcgcaaggcg       720
     gtcgacgaag gcgcggccgg ggtggacatg ggtcgcaaca tcttccagcg tcgagacccc       780
     cacgccatgc tccaggccgt gcgctccgtc gtccacgacg agtggtcgcc cgagaaggcg       840
     gccgagctct accgtgacct ctcccacggc gcggaggact ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page