(data stored in ACNUC1104 zone)

EMBL: CP000509.PE393

CP000509.PE393       Location/Qualifiers
FT   CDS_pept        complement(430197..430586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0400"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: btk:BT9727_2719 conserved hypothetical protein,
FT                   possible polyketide synthesis domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79943"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ8"
FT                   /protein_id="ABL79943.1"
FT                   /translation="MKSGSTNDLEYRFGDHGPAYVIRDPSSEIGVLRLRPGDDMTNHIH
FT                   HFCDESFIVLEGSATLWVGCERRYLLGVGDVYRCSPGEMHYFVNETDAPFRMVFVKSPA
FT                   SPGDTVNLPWTPGQPAPHVPETPAL"
     atgaaatccg gatccaccaa cgatctcgag taccgcttcg gcgaccacgg gccggcctac        60
     gtcatccggg acccgtccag cgagatcgga gtcctgcggc tgcggcccgg cgacgacatg       120
     accaaccaca tccatcactt ctgcgacgag tcgttcatcg tgctggaggg gtccgcgacg       180
     ctgtgggtcg gctgcgagcg gcgctacctc ctcggtgtcg gcgacgtgta ccgctgctcc       240
     cccggcgaga tgcactactt cgtcaacgag accgacgcgc cgttccgcat ggtcttcgtc       300
     aagtcgccgg ccagtcccgg cgacaccgtg aacctgccct ggacaccggg gcaaccggct       360
     ccgcacgtgc cggagacgcc agcactctga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page