(data stored in ACNUC1104 zone)

EMBL: CP000509.PE394

CP000509.PE394       Location/Qualifiers
FT   CDS_pept        complement(430624..432582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0401"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   short-chain dehydrogenase/reductase SDR; KEGG: syn:slr1208
FT                   short-chain alcohol dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79944"
FT                   /db_xref="GOA:A1SDQ9"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ9"
FT                   /protein_id="ABL79944.1"
FT                   /translation="MPFAMSPAASAALTDLVRVSRLLGADPALVLHGGGNTSLKATTTD
FT                   LTGSTVDTLFVKASGHDLASIDAAGFAPLRLARLREILPPVVVPDDLLINELRCALLDA
FT                   AAPDPSVETLLHALLPRPAVIHSHADALLAVANTPDGRERLADLFGDRVILVDYAMPGP
FT                   DLVAACAAAWSREGGNHTQGVVVLGHGLFTVGSTPDEAYQHHVDLVTDVAGLLRASSTR
FT                   GQSQPAAPLPPADPLAVARLRQSLSRAAGHPMVVTSHRDNEVASFVGDDRLLAAAQRGP
FT                   LTPDHVIWTKHSPMIGTDLDAFVRAEDDYFTRHATRRGRTLLRLDGAPRVVLDRTLGML
FT                   TAGRTAGEAARTADIYRHTLGAIELAEALGGYRPVEEEHVFDLEYWSLQQAKLSRKDSH
FT                   RPLSGQVAVVTGAASGIGHACAVSLLESGASVVGWDVSPSVRDAISSPEWLGLAVDVTD
FT                   SAAVTEAIQRGVEAFGGVDILVVAAGIFPTSANLGEMSMQAWRRAMAVNVDAVADLYGQ
FT                   IHPFLAAGTPYGRVVLIASKNVAAPGPGAAAYSASKAAVTQLTRVAALEWAPHGIRVNM
FT                   IHPDAVFDTGLWTPELLEARAEHYGMTVEQYKRRNLLSTEVTSKAVGDLAVTLAGPAFA
FT                   ATTGAQIPIDGGNERVI"
     gtgccattcg cgatgtcccc ggcggcgtcg gccgctctga ccgatctcgt cagggtgtcc        60
     cggctcctgg gtgccgaccc cgcgctcgtc cttcacggcg gcgggaacac gagcctgaag       120
     gccacgacca ccgacctgac cgggtcgacc gtggacaccc tcttcgtcaa ggcgagcgga       180
     cacgacctcg cctcgatcga cgcggccggc ttcgcaccgc tccggctggc acgcctgcgc       240
     gagatcctgc cgcccgtcgt cgttcccgac gacctgctca tcaacgagct gcgctgtgcg       300
     ctgctcgacg cggcggcacc ggatccctcg gtggagaccc tgctgcacgc gctgctgccc       360
     cgaccggccg tcatccactc acacgccgac gcgttgctcg cggtcgccaa cacacccgat       420
     ggccgcgagc ggctcgccga cctcttcggg gatcgcgtga tcctggtgga ctacgccatg       480
     ccgggaccag acctggtggc cgcctgcgcg gccgcctgga gccgggaggg cggcaaccac       540
     acccagggcg tcgtcgtgct ggggcacggc ctgttcaccg tcggctccac gccggacgag       600
     gcgtaccagc accacgtcga tctggtcacg gacgtggccg gcctcctgcg cgcatcctcg       660
     acgcgcggcc agtcgcagcc ggctgcgccc ctgccgcctg cagacccgct ggccgtggcc       720
     cggctgcggc agtccctgag ccgggccgcc gggcacccga tggtggtcac ctcccaccgc       780
     gacaacgagg ttgcgtcctt cgtcggggac gaccgcctgc tcgcggccgc tcagcgcggg       840
     ccgctcaccc ccgaccacgt catctggacc aagcacagcc cgatgatcgg caccgatctg       900
     gacgccttcg tccgggccga ggacgactac ttcacccggc acgccacgcg ccgcggccgc       960
     accctgctgc ggctcgatgg ggcgccccgg gtggtgctcg atcgcaccct cggcatgctc      1020
     accgcgggac gaacggcagg cgaggcggcg cgaaccgcgg acatctaccg gcacaccctc      1080
     ggcgcgatcg agctggccga ggccctcggc ggctaccggc cggtcgagga ggagcacgtc      1140
     ttcgacctcg agtactggtc gctgcagcag gcgaagctct cccgcaagga cagccatcgc      1200
     ccgctctccg gccaggtggc ggtcgtgacc ggcgcggcct cgggcatcgg gcacgcgtgc      1260
     gcggtcagcc tgctggagtc gggcgccagc gtggtgggct gggacgtcag cccatcggta      1320
     cgcgacgcga tctcctcacc ggagtggctc gggctcgccg tcgacgtcac cgactccgct      1380
     gcggtgaccg aggccatcca gcgcggggtg gaggccttcg gtggggtgga catcctcgtc      1440
     gtcgcggcgg gcatcttccc caccagcgcc aacctcggcg agatgtcgat gcaggcctgg      1500
     cgccgggcga tggcggtgaa cgtcgacgcg gtcgcggacc tctacggaca gatccacccg      1560
     ttcctcgccg caggcacccc ttacggccgc gtcgtgctga tcgcgtcgaa gaacgtcgcc      1620
     gccccgggcc ctggcgccgc ggcctactcc gcgtccaagg cagcggtgac ccagctgacc      1680
     cgggtcgcgg ccctcgagtg ggccccccat ggcatccgcg tcaacatgat ccaccccgac      1740
     gccgtgttcg acacgggcct gtggacaccg gagctgctcg aggcgcgagc cgagcactac      1800
     ggcatgacgg tcgagcagta caagcgtcgc aatctcctct ccacggaggt cacgagcaag      1860
     gcggtcgggg acctggccgt caccctggcg ggtcccgcct tcgccgccac gaccggcgcc      1920
     cagattccca tcgacggcgg caacgagcgg gtcatctga                             1959
//

If you have problems or comments...

PBIL Back to PBIL home page