(data stored in ACNUC1104 zone)

EMBL: CP000509.PE395

CP000509.PE395       Location/Qualifiers
FT   CDS_pept        complement(432727..433446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0402"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   tte:TTE0461 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79945"
FT                   /db_xref="GOA:A1SDR0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR0"
FT                   /protein_id="ABL79945.1"
FT                   /translation="MRTRNTLASRIAEDLRGDLSAGTYGPGSRLPTEAQLSENFGVSRP
FT                   TVRAALRELEALGLVQTQHGVGTFVVEQPAVRAGLEGMDSITDSIRATGKVPGMVYATR
FT                   LLRPVLPEEAAFMGVSGDTEVLELRRKLLADGEVVAYSYDLLPATLLPDGFDIQTLEGS
FT                   LFAFLRGVLRIEPDHGVAEVHAVHSDHVGWGDEAKAHDLFVLLNQLHYAGDDRLILYSR
FT                   TYFIEGRYSFTIFRNHR"
     atgaggaccc gcaacacact ggcgtctcgc atcgccgagg acctccgcgg cgacctgtcc        60
     gcggggacct acggccctgg ttcgagactg cctaccgagg cccagctcag cgagaacttc       120
     ggcgtgtcac gcccgaccgt ccgcgccgcg ttgcgcgagc tcgaggcgct ggggctggtg       180
     cagacccagc acggcgtcgg gacgttcgtg gtcgagcagc cggcggtccg cgccgggctg       240
     gagggaatgg actcgatcac ggactcgatc cgcgccaccg ggaaggtccc gggcatggtg       300
     tacgcgaccc ggctgctgcg accggtgctt cccgaagagg ccgcattcat gggggtatcg       360
     ggtgataccg aggtcctcga gctgcgacgc aagctcctgg ccgacggcga ggtggtcgcg       420
     tactcctacg acctcctccc cgcaacgctg ctcccggacg gattcgacat ccagacgctg       480
     gaggggtccc tgttcgcatt cctgcgcggt gtgctccgga tcgagcccga ccacggggtc       540
     gcggaggtgc atgcggtgca ctccgaccac gtggggtggg gcgatgaggc gaaggcccac       600
     gatctcttcg tgctgctgaa ccagctgcac tacgccggtg acgaccggtt gatcctctac       660
     tcgcgcacct acttcatcga gggccgctac tccttcacga tcttccgcaa ccaccgctga       720
//

If you have problems or comments...

PBIL Back to PBIL home page