(data stored in ACNUC1104 zone)

EMBL: CP000509.PE397

CP000509.PE397       Location/Qualifiers
FT   CDS_pept        434682..435788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0404"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="KEGG: ret:RHE_PB00122 probable sugar ABC
FT                   transporter, substrate-binding protein; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79947"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR2"
FT                   /protein_id="ABL79947.1"
FT                   /translation="MRMNKLIVAGVAAVSALSLAACSQGSGATTAEPKAQDSASVQAAS
FT                   GDAPAPFDQAGVRVAIVQNSGQGDYFQQYLNGTKQQAAALGIDLSVYDAQGDNATQATQ
FT                   LDQAISSGVQGIIVRHGFPDTLCPGVNKAIDQGIKVVIYDVEIQKCAPQAVQTQQSDNK
FT                   MASLVLDKMAEDIGTGKPVGYVNVAGIAPLDRRDLVWQDYLATNDWTQKFKTGKFTNST
FT                   ATDTAPMVDSVLKSNPDVVAVYAPYDELTKATLSALKQNPSLQGKVKVYGADISTADIE
FT                   LMTNPDSPWVATGATDPNAIGAAVVRTLALHMAGELDGLNVEFPPILVTQDFLRSEGIK
FT                   NMDDLRAAEPALNIADVSSADWIPAVTF"
     atgaggatga acaaactcat cgtggccggt gtcgccgcgg tgtctgcctt gagcctcgct        60
     gcctgtagcc agggaagcgg cgccaccact gcggagccga aggcccagga ctccgcctcc       120
     gtgcaggcgg cgagcgggga cgcacctgcg ccgttcgacc aggccggggt ccgcgtggcc       180
     atcgtgcaga acagcggcca gggtgactac ttccagcagt acctgaacgg cacgaagcag       240
     caggcggcag cgctcgggat cgacctgagc gtgtacgacg cccagggcga caacgccacg       300
     caggcgaccc agctcgatca ggccatctca tccggcgtgc agggcatcat cgtgcgccac       360
     ggcttccccg acacgctctg cccgggcgtc aacaaggcga tcgaccaggg catcaaggtc       420
     gtcatctacg acgtcgagat ccagaagtgc gcgccgcagg ccgtgcagac ccagcagtcc       480
     gacaacaaga tggcgagcct cgtgctggac aagatggccg aggacatcgg caccggcaag       540
     ccggtcggct acgtcaacgt cgccggtatc gcgccgctgg accgccggga cctcgtgtgg       600
     caggactacc tggccacgaa cgactggacc cagaagttca agaccggcaa gttcacgaac       660
     tccacggcca cggacaccgc gccgatggtg gacagcgtct tgaagtccaa cccggacgtg       720
     gtcgccgtct acgcgccgta cgacgagctc accaaggcga ccctctccgc gctgaagcag       780
     aatccgagcc tgcagggcaa ggtcaaggtc tacggcgccg acatctccac ggccgacatc       840
     gagctcatga ccaacccgga cagcccgtgg gtggcgaccg gcgcgacgga ccccaacgcc       900
     atcggtgctg cggtggtccg cacgctcgca ctccacatgg ccggcgagct ggacgggctc       960
     aacgtcgagt tcccgccgat cctggtcacg caggacttcc tgcggtcgga ggggatcaag      1020
     aacatggatg atctgcgtgc agcggagccg gcgctgaaca tcgccgacgt gtcgtccgcc      1080
     gactggatcc cggccgtcac gttctga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page