(data stored in ACNUC1104 zone)

EMBL: CP000509.PE4

CP000509.PE4         Location/Qualifiers
FT   CDS_pept        4254..5516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: sma:SAV4319 putative DNA
FT                   recombination and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79554"
FT                   /db_xref="GOA:A1SCL9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SCL9"
FT                   /protein_id="ABL79554.1"
FT                   /translation="MYVAHLSLHDFRSYATAEVELSPGVTAFIGRNGQGKTNLVEAIDY
FT                   LSRLSSHRVASDAPLVRAGADQAVVRAAVVRDGRTAVLEVELNPGRSNRARVNRSPLPR
FT                   ARDLVGLVRTVVFSPEDLTLVKGDPADRRRFLDDLLVLRVPRLAGVRADYDRVLRQRNT
FT                   LLKTARKGGFARKGGFARKGGFAPLGPPEGRPEGPPEGRTGGSATSGPPSRSVALDTLA
FT                   VWDAHLARTGAELLAERLALVEALRPYVGKAYETVARGATRDDAEIDYKPSFDLEGRTG
FT                   RDDLVEALLAEVERRRGDELDRGVSLVGPHRDELLLTLGHGSPDSRLPVKGYASHGESW
FT                   SFALALRLAAYDLLRADGDDPILILDDVFAELDTERRAQLADLVAGAEQVLVTAAVAAD
FT                   VPAGLAGARFAVGNGEVLREQ"
     gtgtacgtcg cgcacctctc gctccacgac ttccggtcct acgccacggc cgaggtcgag        60
     ctgtccccgg gcgtcacggc gttcatcggc cgcaacggac agggcaagac caacctcgtc       120
     gaggcgatcg actacctctc ccggctgagc tcgcaccgcg tcgccagcga cgccccgctg       180
     gtgcgggccg gcgcggacca ggccgtggtg cgggccgcgg tcgtgcgcga cgggcgtacg       240
     gcggtgctcg aggtcgagct caaccccggc cggtcgaacc gcgcccgggt gaaccgctcc       300
     ccgctccccc gggcccgcga tctcgtgggg ctggtgcgca cggtcgtgtt ctccccggag       360
     gacctgaccc tggtcaaggg cgacccggcc gaccggcgcc gcttcctcga cgacctgctg       420
     gtgctgcgcg tgccccggct cgcgggagtg cgtgccgact acgaccgggt cctgcggcag       480
     cgcaacacgc tcctcaagac agcacgcaag gggggcttcg cacgcaaggg gggcttcgca       540
     cgcaaggggg gcttcgcccc ccttggaccc cccgaaggac gccccgaggg accccccgag       600
     ggacgcacgg gaggctctgc tacctctggg ccccccagtc ggtcggtcgc cctggacacg       660
     cttgccgtgt gggacgcgca cctggcccgc accggtgccg agctgttggc cgagcggctc       720
     gccctggtgg aggcgctgcg gccgtacgtc ggtaaggcct acgagaccgt cgcacgtggg       780
     gccacccgcg acgacgccga gatcgactac aagccgtcct tcgacctcga ggggcgcact       840
     ggccgcgacg acctggtcga ggcgctgctc gccgaggtgg aacggcgtcg cggtgacgag       900
     ctcgaccgcg gggtctcgct cgtcggcccg caccgcgacg agctgctgct gacgctcggc       960
     cacggcagtc ccgacagccg gctcccggtg aagggctacg cctcgcacgg cgagtcgtgg      1020
     tcgttcgcgc tcgcgttgcg gctcgcggcg tacgacctgc tccgcgccga cggtgacgac      1080
     ccgatcctga tcctcgatga cgtcttcgcc gagctggaca ccgaacgccg cgcccagctc      1140
     gccgacctcg tggccggcgc cgagcaggtg ctcgtcacgg cggccgtcgc ggccgacgtc      1200
     ccggccggcc tcgccggcgc ccgcttcgca gtcgggaacg gcgaggtcct ccgtgagcag      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page