(data stored in SCRATCH zone)

EMBL: CP000509.PE40

CP000509.PE40        Location/Qualifiers
FT   CDS_pept        45212..46573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0040"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG:
FT                   bur:Bcep18194_B1168 MmgE/PrpD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79590"
FT                   /db_xref="GOA:A1SCQ5"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCQ5"
FT                   /protein_id="ABL79590.1"
FT                   /translation="MRTVLSTYTEQLAEYVTATTYDALPTSTVAAAKRVTLDLIGVVLP
FT                   AINYGPGSVMNQYVRETGGPGQATVVGTDIKTNAANAALANGTMAADMEQDDVHPESNL
FT                   HASSVFVPAMLGVAEELGSSGRDWINALAVAYDVGCRISIAMDNGRQYASGFHPTAVSG
FT                   TFGAAAAVARLLGLDAAGVNSTIGLTGCQAAGMLTWEMETEHYTKSFQSGVPARNAVVA
FT                   AQLAARGYVGASNTLDGKYNVFDAFSNHRNFSRLVENLGDRHEIEYTGYKFYSVCRFIH
FT                   SAIDQLLDLSAEHGFAGADIESLDVWLPHTQVPIVDHNTLITHNLQYSLAVGITDRVVE
FT                   RAQTSNERFADPALQAIAAKVTLRGADDLEALYPAHWPSRVHIRLTDGRTFDSEKHDPR
FT                   GTSFVPVTDADIVAKFEGMASQVLPAERVNQIVKIVDELETLDSIRELTALLVP"
     atgaggactg tcttgagcac ctacaccgag cagctggccg agtacgtcac cgccacgacc        60
     tacgacgcgc tgcccacctc gaccgtggcc gccgccaagc gcgtgacgct cgacctgatc       120
     ggcgtcgtcc tgccggccat caactacggc cccggcagcg tgatgaacca gtacgtgcgg       180
     gagaccggcg gccccggtca ggccaccgtc gtcggcaccg acatcaagac gaacgccgcc       240
     aacgccgccc tcgccaacgg gacgatggcg gcggacatgg agcaggacga cgtccacccc       300
     gagtcgaacc tgcacgcgag cagcgtcttc gtcccggcga tgctgggcgt tgccgaggag       360
     ctcggttcct cgggccgcga ctggatcaac gccctggccg tcgcctacga cgtcggctgc       420
     cggatctcca tcgcgatgga caacggccgg cagtacgcga gcggcttcca cccgacggca       480
     gtctccggca ccttcggtgc cgcggccgcg gtggcacggc tcctcggcct cgacgccgcc       540
     ggtgtcaaca gcaccatcgg tctcaccggc tgccaggcgg ccggcatgct cacctgggag       600
     atggagaccg agcactacac caagtccttc cagagtgggg ttccggcgcg caacgcggtc       660
     gtggccgcgc agctcgccgc ccggggctac gtcggcgcca gcaacaccct cgacgggaag       720
     tacaacgtct tcgacgcgtt ctccaaccac cggaacttct cgcggctggt ggagaacctc       780
     ggcgaccgcc acgagatcga gtacaccggg tacaagttct actcggtgtg ccgcttcatc       840
     cactcagcca tcgaccagtt gctcgatctg tccgcggaac acggtttcgc gggcgccgac       900
     atcgagagcc tcgacgtctg gctgccgcac acgcaggtgc cgatcgtcga ccacaacacg       960
     ctgatcaccc acaacctcca gtactcgctc gcggtgggta tcaccgaccg ggtcgtcgag      1020
     cgcgcacaga cctcgaacga gcgcttcgcg gaccccgcgc tgcaggcgat cgcggcgaag      1080
     gtgacccttc gcggggccga cgacctggag gccctctacc ccgcccactg gccctcgcgc      1140
     gtgcacatcc gcctcaccga cggccggacc ttcgacagcg agaagcacga cccgcggggc      1200
     acctcgttcg taccggtgac cgacgctgac atcgtcgcga agttcgaggg catggcctcc      1260
     caggtcctgc ccgcagagcg ggtcaaccag atcgtcaaga tcgtcgacga gctcgagacc      1320
     ctcgactcca tccgcgagct aacggccctg ctggtgccgt ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page