(data stored in SCRATCH zone)

EMBL: CP000509.PE400

CP000509.PE400       Location/Qualifiers
FT   CDS_pept        438509..439738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0407"
FT                   /product="5'-methylthioribose kinase"
FT                   /EC_number="2.7.1.100"
FT                   /note="TIGRFAM: 5-methylthioribose kinase; KEGG:
FT                   yps:YPTB0878 5-methylthioribose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79950"
FT                   /db_xref="GOA:A1SDR5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR009212"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR5"
FT                   /protein_id="ABL79950.1"
FT                   /translation="MMSDYEFLTVDTVASYIESRPVLASRVDTVALASVEEIGDGNLNL
FT                   VFLVKDRHGRGLCLKQALPYVRMTGEAWPMTPDRARHEVESLRAHHALIPDHVVEVFDY
FT                   HPERYIIAMEDLSDHRVWRGALNEGLRHDGAAEAMGAYVGAVAFGTSAFGLERHALADA
FT                   VSASVNPALCTITEDLVFTEPLVDAGRNSVLPANEKDAAELAADDAMVRAMGRAKWLFM
FT                   TQAEALIHGDLHTGSVMVRAVDGSSRCDSVKAFDSEFAFYGPVAFDLGALWGNYAIAAA
FT                   RALALGQDERAAWALGLVQQTWDGFEGEFRRRWPSRLDARVWRDDTLQDLLREWENEAW
FT                   LFAAAKMSRRIVGAAKTADIETLPEELREGAARGVLRAARTLVRHSTSENGPRVVAGRV
FT                   GEVLAEHCTR"
     atgatgtccg actacgagtt cctcaccgtg gacacggtgg cgtcctacat cgagtcccgg        60
     ccggtcctcg ccagccgtgt cgataccgtc gccctcgcga gcgtcgagga gatcggcgac       120
     ggcaacctca acctggtgtt cctcgtcaag gaccggcacg gacgcggcct gtgcctgaaa       180
     caggcgctgc cctacgtccg gatgaccggt gaggcgtggc cgatgacgcc ggaccgagcc       240
     cgccacgagg tcgagtcgct ccgagcccac cacgccctga tccccgacca tgtggtggag       300
     gtcttcgact accaccccga gcggtacatc atcgcgatgg aggacctcag cgaccaccgg       360
     gtgtggcgag gcgcgctcaa cgagggcctg aggcacgacg gagcggccga ggcgatgggg       420
     gcctacgtcg gcgccgtcgc cttcggcacc tccgccttcg gtctcgagcg tcacgcgctc       480
     gcggacgccg tgagcgcctc ggtgaacccg gccctgtgca cgatcaccga ggacctcgtg       540
     ttcaccgagc cgctcgtcga cgccggccgc aactccgtac tcccggccaa cgagaaggat       600
     gctgcggagc tcgccgccga cgacgccatg gtccgggcga tgggccgcgc caagtggctg       660
     ttcatgaccc aggcggaggc cctgatccat ggcgacctcc acaccgggtc ggtcatggtc       720
     cgtgccgtcg acggctcgtc gcgctgcgac tccgtcaagg ccttcgactc ggagttcgcc       780
     ttctacgggc cggtcgcctt cgacctgggc gcgctctggg ggaactacgc catcgcggcg       840
     gcgcgtgccc tcgcccttgg ccaggacgag cgggccgcat gggcactcgg gctcgtccag       900
     cagacctggg atggcttcga gggggagttc cgccgtcggt ggccgtcgcg cctggacgcc       960
     cgggtatggc gcgacgacac actgcaggac ctgctccgtg agtgggagaa cgaggcctgg      1020
     ctgttcgcgg cggcgaagat gtcgcgccgg atcgtgggtg ccgcgaagac cgccgacatc      1080
     gagaccctgc ccgaggagct ccgcgaaggc gccgcgcgtg gtgtcctccg ggcggcacgc      1140
     acgctcgtcc ggcactcgac cagcgagaac ggtccgcgcg tcgtggccgg ccgggtcggc      1200
     gaggtgctgg ccgagcactg cacgcggtga                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page