(data stored in ACNUC1104 zone)

EMBL: CP000509.PE401

CP000509.PE401       Location/Qualifiers
FT   CDS_pept        complement(439817..442225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0408"
FT                   /product="Thrombospondin type 3 repeat"
FT                   /note="PFAM: Thrombospondin type 3 repeat; KEGG:
FT                   ade:Adeh_3645 outer membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79951"
FT                   /db_xref="GOA:A1SDR6"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR6"
FT                   /protein_id="ABL79951.1"
FT                   /translation="MDRKSSLVLLLLLALALVGMGAPAASSPSSEFVRPSWGDGQLPAG
FT                   CVVDRDPLNPDNLCYHMKVGLNALDSPKVDVDVLVPVSPAAERDMRVAEQAVMMWEGGL
FT                   HHLADQMDLPWLKDGFDMNVRTHQVVVDPTGALQQPLALVDPEIVVIVSNPAGGVGIGI
FT                   DPVSFAGELGIIDGEGAPCAAVPSPLDFGTWTDKPGFEQHGREKGGVYVEDCGGVGGNV
FT                   CFAVNGAVDPVPGASDFFGLFDLVAHEFGHCLTLGHVGDGADGPWGPTPTNDIMAYSTD
FT                   PPGVAKCVSTLDVEGFALRMSRYLDVNGDGAVDRHDHLAPNDVRGDGFNSFQVQHPDDH
FT                   LYASSTGDPADCPQPELGPVPLSYGSWSPKPVATTRPVLRTSSLQVTNGHVHVRGDATN
FT                   EPLGKTPTQRSARATDATSDSPTPVTDLTGVQVSVTRRTVDATMSVTQVWPVAQGGSAT
FT                   AYSLLVSGRRFDSFICTGDTSGTPQVMDNGTGYYLPGGSATWNYDDNTVTFHIRRDYLA
FT                   DQQIEAPYTVNAITGLHARGNDWIATTDAAPDGAGLRLAAPPMGAETRDAPVARTVRTA
FT                   RVELTPEGGASVLPTDSTLGVGLVSAVDSRDYFDLPIAKQATAEVTLSWTGSTIFGLSV
FT                   NGGSGQQVAEQDGRITVTVPWARRDLSITVDPQEVVEPTTYTLTARLTTVRADHDRDRV
FT                   PDVADRCPTRPGPSASSGCPDTDADGILDRDDRCPTEASASASGCPTDGDERVVLIVDG
FT                   RRLAAQTVVTAHGSAAFTLDGVVGRGTHRVVLAWIRDGKVVARISRRAG"
     atggatcgca agagctccct cgtccttctc ctgctgctcg ccctcgccct ggtggggatg        60
     ggcgcgccgg cggccagcag cccgtcgagc gagttcgtcc gtccgagctg gggtgacggt       120
     cagctgcccg caggctgcgt ggtcgaccgc gacccgctca accccgacaa cctctgctac       180
     cacatgaagg tgggcctgaa cgccctcgac tccccgaagg tcgatgtcga cgtgctggtg       240
     ccggtctccc ccgcggccga gcgtgacatg cgggtcgccg agcaggccgt gatgatgtgg       300
     gaaggcggcc tgcaccatct cgccgaccag atggacctgc cctggctgaa ggacgggttc       360
     gacatgaacg tccgcaccca ccaggtcgtg gtcgacccca ccggagcgct gcagcagccc       420
     ctcgccctgg tcgatcccga gatcgtcgtg atcgtcagca acccggccgg cggggtcggc       480
     atcgggatcg acccggtgtc gttcgccggc gagctcggga tcattgacgg cgagggcgct       540
     ccgtgcgccg ccgtgccctc cccgctggac ttcggcacgt ggacggacaa gccggggttc       600
     gagcagcacg gccgcgagaa gggcggtgtg tacgtcgagg actgcggcgg cgtcggcggc       660
     aacgtctgct tcgccgtcaa cggcgcggtg gacccggtgc ccggcgcgtc cgacttcttc       720
     ggcctcttcg acctggtggc ccacgagttc ggccactgcc tcaccctggg ccacgtgggc       780
     gacggcgccg acggcccctg gggcccgacg ccgaccaacg acatcatggc ctacagcacc       840
     gacccgccgg gcgtcgccaa gtgcgtctcc accctcgacg tcgagggctt cgcgctgcgg       900
     atgagccggt acctcgacgt caacggagac ggggcggtgg accggcacga ccacctcgcc       960
     cccaacgacg tccggggcga cgggttcaac tcgttccagg tgcagcaccc cgacgaccac      1020
     ctctacgcct cctcgaccgg ggaccctgcg gactgcccgc agcccgagct cggtcccgtc      1080
     ccgctcagct acggcagctg gagcccgaag cccgtcgcca cgacacgtcc ggtgctgcgg      1140
     acctcctccc tgcaggtcac caacggccac gtgcacgtgc gcggtgacgc caccaacgag      1200
     cccctcggca agacgccgac ccagcgcagc gcgcgggcga ccgacgccac gtccgactcg      1260
     cccaccccgg tcacggacct gaccggcgtc caggtgtcgg tgacgcgcag gacggtggac      1320
     gcgacgatgt cggtcaccca ggtgtggccg gtcgctcagg gcgggtcggc cacggcgtac      1380
     agcctgctcg tctcggggcg ccgcttcgac tccttcatct gcaccgggga cacgtccggc      1440
     accccgcagg tgatggacaa cggcaccggc tactacctgc ccgggggcag cgcgacctgg      1500
     aactacgacg acaacaccgt caccttccac atccgccgcg actacctggc cgaccagcag      1560
     atcgaggcgc cgtacacggt caacgccatc accggcctgc acgcgcgcgg caacgactgg      1620
     atcgcgacca cggacgccgc tccggacggc gccgggctgc gcctggccgc gccgccgatg      1680
     ggcgccgaga cccgcgacgc gccggtcgcc cggacggtgc ggaccgcacg ggtcgagctg      1740
     accccggagg gcggcgccag cgtcctgccc accgacagca cgctcggcgt cggcctggtc      1800
     agcgccgtcg acagccgcga ctacttcgac ctgccgatcg cgaaacaggc gaccgccgag      1860
     gtcaccctga gctggaccgg ctccacgatc ttcggcctct ccgtcaacgg cggctcgggg      1920
     cagcaggtgg cggagcagga cggccgcatc accgtcaccg tcccgtgggc ccgccgggac      1980
     ctgtcgatca ccgtcgaccc gcaggaggtc gtcgagccga cgacctacac gctgaccgcc      2040
     cgactgacca cggtgcgggc cgaccacgac cgcgaccggg tgccggacgt cgccgaccgg      2100
     tgcccgaccc ggcccgggcc cagcgccagc agcggctgcc ccgacaccga cgccgacggc      2160
     atcctcgacc gggacgaccg gtgcccgacc gaggcctcgg cgagcgcgtc cgggtgcccg      2220
     acggacggcg acgaacgggt cgtcctgatc gtcgacggga ggcggctggc cgcacagacg      2280
     gtggtcaccg cccacggcag cgcggccttc accctcgacg gcgtggtcgg ccgaggcacg      2340
     caccgcgtgg tgctcgcctg gatccgtgac ggcaaggtcg tcgcgcggat cagccggcgg      2400
     gccgggtag                                                              2409
//

If you have problems or comments...

PBIL Back to PBIL home page