(data stored in SCRATCH zone)

EMBL: CP000509.PE404

CP000509.PE404       Location/Qualifiers
FT   CDS_pept        complement(443569..444246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0411"
FT                   /product="Vitamin K epoxide reductase"
FT                   /note="PFAM: Vitamin K epoxide reductase; KEGG: blo:BL0088
FT                   narrowly conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79954"
FT                   /db_xref="GOA:A1SDR9"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="InterPro:IPR041714"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR9"
FT                   /protein_id="ABL79954.1"
FT                   /translation="MTHAPGTDKRSTGGLGTDEELAEGSRLHRLRHSRATVWVTMLVAS
FT                   VASLVASFVLSIDALRLAEDPNADLGCNINAVISCGTVANSWQSSLLGFPNAFLGLVTE
FT                   PVVITLAVASLAGIRFPRWFMLAAQAVYTVGLAFAYWLFYEAMFDIGALCPWCLLVTLA
FT                   TTLVFFEMTYVNIRDANLYLPRRVQAGLVAMVRSNLDLVLVVAWILVLVLAVVLKYGDA
FT                   LFA"
     gtgacccacg cgccgggcac cgacaagcgg tccaccggcg ggctgggcac cgacgaggag        60
     ctggccgagg gctcgcgcct gcaccggctg cggcacagcc gcgccaccgt ctgggtgacg       120
     atgctggtgg cctcggtcgc gagcctggtg gcctccttcg tcctctcgat cgacgccctg       180
     cgcctggccg aggacccgaa cgccgacctc ggctgcaaca tcaacgccgt catcagctgc       240
     ggcaccgtgg ccaactcctg gcagtcctcg ctgctcgggt tccccaacgc cttcctcggc       300
     ctggtcaccg aaccggtggt gatcaccctg gccgtcgcca gcctggccgg aatccggttc       360
     ccgcgctggt tcatgctggc cgcgcaggcc gtctacacgg tcggcctcgc gttcgcctac       420
     tggctcttct acgaggccat gttcgacatc ggggcgctct gcccgtggtg cctgctggtg       480
     acgctcgcga cgaccctggt cttcttcgag atgacctacg tgaacatccg cgacgccaac       540
     ctgtacctgc cccgccgggt ccaagccggc ctggtcgcca tggtccgctc gaacctcgac       600
     ctcgtgctgg tcgtcgcctg gatcctggtg ctggtgctgg ccgtcgtgct gaagtacggc       660
     gacgccctgt tcgcctga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page