(data stored in ACNUC1104 zone)

EMBL: CP000509.PE405

CP000509.PE405       Location/Qualifiers
FT   CDS_pept        complement(444243..445073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0412"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: nfa:nfa52230
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79955"
FT                   /db_xref="GOA:A1SDS0"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDS0"
FT                   /protein_id="ABL79955.1"
FT                   /translation="MSTAGHDHRPGLPKNDHRKSRMSKQGRIRTQQMREQQRIVEEQQA
FT                   RRRRLVTAVGAVVILGLVAAIVFAVVRTVTGDDDSAPAASGPLVAPANIEPSGSFAVGQ
FT                   DDAPVTVEIYYDYMCPACGAFEAANSGELDRLVADGTARIELRPISFLDEQSRGTRYST
FT                   RAANAFATVVHGAPDRAWAFHSALYENQPAEGTEGLSNDQIAAIARDAGVPDDVVEQFG
FT                   EGTYEPWTASVTQKAFDSGIQGTPTVVIDGEQFQGDVYTVGPLTEAIESAAGSQ"
     gtgtcgacgg caggccacga ccacagaccg ggcctgccca aaaacgacca caggaagtcg        60
     cggatgagca agcagggacg gatcaggacc cagcagatgc gcgagcagca gcgcatcgtc       120
     gaggagcagc aggcgcgtcg ccgccggctc gtgaccgcgg tcggcgccgt cgtgatcctc       180
     ggcctggtcg cagccatcgt cttcgcggtc gtgcgcacgg tgaccggcga cgacgacagc       240
     gcacccgcag cctccgggcc gctggtggcg ccggcgaaca tcgagccctc cgggtcgttc       300
     gcggtcggcc aggacgacgc accggtcacg gtcgagatct actacgacta catgtgcccc       360
     gcctgtggcg ccttcgaagc ggccaacagt ggcgagctcg accggctggt cgccgacggc       420
     accgcgcgga tcgagctgcg cccgatctcc ttcctcgacg agcagtcgcg cggcacccgg       480
     tactccaccc gcgccgccaa cgcgttcgcg accgtggtcc acggtgcgcc ggaccgggcc       540
     tgggccttcc acagtgcgct ctacgagaac cagccggccg agggcaccga gggcctcagc       600
     aacgaccaga tcgccgcgat cgcccgggat gccggcgtgc ccgacgacgt cgtcgagcag       660
     ttcggcgagg gcacctacga gccctggacc gcctcggtga cgcagaaggc gttcgactcc       720
     ggcatccagg gcaccccgac cgtcgtcatc gacggcgagc agttccaggg cgacgtgtac       780
     acggtcggcc cgctgaccga ggcgatcgag tccgccgcgg gcagccagtg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page