(data stored in SCRATCH zone)

EMBL: CP000509.PE408

CP000509.PE408       Location/Qualifiers
FT   CDS_pept        448056..448667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0415"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   eca:ECA3669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79958"
FT                   /db_xref="GOA:A1SDS3"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDS3"
FT                   /protein_id="ABL79958.1"
FT                   /translation="MSSVLVPPPHTRLEDLLSLVTGVYVVSLGLSFLQASGAVTGGTAG
FT                   LALLLSYATPIGFGVLFVLINLPAFAVAAWKKGWPFTVKSLACVVGVSFATRLQAEVLD
FT                   LPDLDKLYGVVAGNLLAGVGLLILFRHGASLGGFNIIALLMQEKLGLRAGYVQMVLDVM
FT                   VVLGSAFVVDPGIVVLSALGAVVLNIVLAFNHRPGRYMGL"
     atgagctcgg tactggtgcc gccgccgcac acgcggctgg aggacctgct gagcctggtc        60
     acgggcgtct acgtcgtctc cctcggcctg agcttcctcc aggcctcagg ggcggtcacg       120
     ggcggcaccg ccggtctcgc cctgctgctc tcctatgcga ccccgatcgg gttcggcgtg       180
     ctgttcgtgc tgatcaacct gcccgcgttc gcggtggccg cgtggaagaa gggctggccg       240
     ttcacggtga agtcgctcgc ctgcgtcgtc ggggtgtcgt tcgcgacccg gctgcaggcg       300
     gaggtgctgg acctgcccga cctcgacaag ctctacgggg tggtcgcggg caacctgctg       360
     gccggcgtgg gcctgctgat cctgttccgg cacggggcga gcctgggcgg cttcaacatc       420
     atcgcgctgc tcatgcagga gaagctcggc ctccgggccg gctacgtgca gatggtcctc       480
     gacgtgatgg tcgtgctcgg gtccgcgttc gtcgtcgacc cgggcatcgt ggtgctctcg       540
     gcgctcggcg ccgtcgtgct caacatcgtg ctggccttca accaccggcc gggccggtac       600
     atgggcctct ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page