(data stored in ACNUC1104 zone)

EMBL: CP000509.PE415

CP000509.PE415       Location/Qualifiers
FT   CDS_pept        454035..454358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0423"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="KEGG: fal:FRAAL1608 hypothetical protein; putative
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79965"
FT                   /db_xref="GOA:A1SDT0"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT0"
FT                   /protein_id="ABL79965.1"
FT                   /translation="MVGYAALVAVLAVVAARRGERPGWLDQMAWMLEVLLLVRALAGLG
FT                   PLLGDDRPDSTSTYVGYLFASVCVLPIAMRSVAGDRAAWSSAVVAVAAVAVGVVAVRLQ
FT                   MTA"
     gtggtcgggt acgccgcgct cgtcgccgtc ctggcggtgg tggccgcccg gcgtggcgag        60
     cgccccggct ggctcgacca gatggcgtgg atgctcgagg tgctgctcct cgtgcgcgcg       120
     ctcgcgggcc tgggtcccct gctgggcgat gaccgacccg actcgacctc gacgtacgtc       180
     ggctacctgt tcgcctcggt gtgcgtgctg ccgatcgcga tgcgctcggt cgcgggggac       240
     cgggcggcct ggtcctccgc cgtggtggcc gtggccgcgg tcgcggtcgg ggtggtcgcc       300
     gtacgcctgc agatgaccgc atga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page