(data stored in SCRATCH zone)

EMBL: CP000509.PE42

CP000509.PE42        Location/Qualifiers
FT   CDS_pept        48055..49050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0042"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: lin:lin0218 similar to
FT                   sugar ABC transporters, permease proteins; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79592"
FT                   /db_xref="GOA:A1SCQ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCQ7"
FT                   /protein_id="ABL79592.1"
FT                   /translation="MRARAIPEAEPESVVAAPPADRSSGQLRQRRERRQRRQRPRGDWL
FT                   NLLLFLGVPIVLIVAVEIIPMLGVVWISLTDYNPLEPDSWTEFVGGENYSRMLDDSLFW
FT                   KSLGNTFFFAVLYLPISILGALLAATLLNQNLRGRLVYRGIFFMPVVVSWVVASTMIMW
FT                   FLDPSSGFVSMVSQELGFGRLPQLLQDESTAMPAVAFVAIWKYFGYNTVIYLAGLQSVN
FT                   PALEEAAKVDGASAFGRFWYVTLPALRPVTAVVVMLNMIQAIRIFDPMLIMTNGGPNYA
FT                   TTSTVLYVYRMAWDNLEFGYGSAITGALSLIIFAIAGLQFWFFNRRSVEG"
     atgagagcgc gcgcgatccc agaagctgag cccgagagcg ttgtcgcggc tccacccgcg        60
     gaccgaagta gcggacagct tcggcagcgg cgggagcggc ggcaacgccg gcagcggccc       120
     cgtggggact ggctcaacct cctgctgttc ctcggcgtcc cgatcgtcct catcgtggca       180
     gtcgagatca ttcccatgct gggcgtggtc tggatcagcc tcaccgacta caacccgctc       240
     gagccggaca gctggacgga gttcgtcggc ggcgagaact acagtcgcat gctcgacgac       300
     tccctgttct ggaagtcgct cgggaacacc ttcttcttcg cggtcctgta cctcccgatc       360
     tcgatcctcg gtgcactcct cgcggcgacg ctcttgaacc agaatctccg cgggaggctg       420
     gtctaccgag gcatcttctt catgcccgtg gtggtgtcct gggtcgtggc ctccaccatg       480
     atcatgtggt tcctggaccc ctcctcaggg tttgtctcga tggtcagcca ggagctcggt       540
     ttcggccggc tgccgcagct gctgcaggac gagtcgaccg ccatgccagc ggtcgcgttc       600
     gtcgcgatct ggaagtactt cggctacaac accgtcatct acctggctgg cctgcagtcg       660
     gtgaatcctg cgctggagga ggcggccaag gtcgacgggg cttccgcgtt cggccggttc       720
     tggtacgtca cgttgccggc cctgcgcccc gtgaccgcgg tcgtggtcat gctcaacatg       780
     atccaggcga tccggatctt cgaccccatg ctgatcatga cgaacggcgg tccgaactac       840
     gcgaccacct cgacggtcct ctacgtctac cgcatggcgt gggacaacct cgagttcggc       900
     tacggcagcg ccatcaccgg cgccctttcg ctgatcatct tcgcgatcgc gggcctccag       960
     ttctggttct tcaaccgaag gagcgtcgag gggtga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page