(data stored in ACNUC1104 zone)

EMBL: CP000509.PE421

CP000509.PE421       Location/Qualifiers
FT   CDS_pept        complement(459234..459677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0429"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rha:RHA1_ro06613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79971"
FT                   /db_xref="GOA:A1SDT6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT6"
FT                   /protein_id="ABL79971.1"
FT                   /translation="MITITAGPFTALDAPTAYAVWRLRQDVFVVEQECPYPDLDGRDDE
FT                   PDTRHVLLRDDDTLLGYARVLDEERDGQAVWRIGRVVLDRAVRGQGLADPLVQTALQVC
FT                   KDRDVVLDAQSPLAPWYATFGFEVSGPEFLEDGIPHTPMRLSR"
     atgatcacga tcaccgccgg cccgttcacc gccctggacg ccccgacggc gtacgccgtc        60
     tggcggctgc gccaggacgt gttcgtcgtc gagcaggagt gtccctaccc cgacctcgac       120
     ggccgcgacg acgagccgga cacccgtcac gtgctgctcc gcgacgacga caccctcctc       180
     ggctacgccc gggtgctcga cgaggagcgc gacggccagg cggtctggcg gatcggccgg       240
     gtggtgctgg accgagcggt ccgcggccag ggcctggccg acccactggt gcagaccgcg       300
     ctccaggtgt gcaaggaccg cgacgtggtg ctcgacgcgc agtcgccgct ggcgccgtgg       360
     tacgcgacgt tcgggttcga ggtgtcgggc ccggagttcc tcgaggacgg gatcccgcac       420
     accccgatgc ggctcagccg ctga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page