(data stored in ACNUC1104 zone)

EMBL: CP000509.PE424

CP000509.PE424       Location/Qualifiers
FT   CDS_pept        461272..462150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0432"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /note="PFAM: DNA gyrase C-terminal repeat, beta-propeller;
FT                   sigma-70 region 2 domain protein; sigma-70 region 4 domain
FT                   protein; Sigma-70, region 4 type 2; KEGG: sco:SCO2742
FT                   putative sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79974"
FT                   /db_xref="GOA:A1SDT9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT9"
FT                   /protein_id="ABL79974.1"
FT                   /translation="MNATDSTDVFVDHRNLLFTVAYEMLGSAADAEDVLQETWLRWVEV
FT                   DREEVREARAYLVRIATRLALNRMRTNARRRESYVGPWLPEPLLTTPDVAEDVELADSV
FT                   SLAMLTLLETLGPTERAVFVLREVFDFGYDEIAAAVDKTPAAVRQIAHRARGHVAERRP
FT                   RAEATRSEREHVMATFLAAVATGDIQSLMDVLAPDVVLVTDGGGVKKAALRPILGRDKV
FT                   VRFLGAVSEGLDAVADVVVVNGAPALRIVLDGELDTVASMVVEDGLVTGLYVVRNPAKL
FT                   ARLDAVVTLTR"
     atgaacgcca ccgattccac cgacgtcttc gtcgaccacc gcaacctgct cttcacggtc        60
     gcctacgaga tgctcggctc ggccgcggac gccgaggacg tgctgcagga gacctggctg       120
     cgctgggtcg aggtcgaccg cgaggaggtg cgcgaggcgc gcgcctacct ggtgcggatc       180
     gccacccggc tcgcgctgaa ccggatgcgc acgaacgccc ggcgccggga gtcgtacgtc       240
     ggaccgtggc tccccgagcc gctgctcacc accccggacg tggcggagga cgtcgagctc       300
     gccgacagcg tctccctggc gatgctcacg ctgctcgaga cgctcggccc gaccgagcgc       360
     gcggtgttcg tgctgcgcga ggtcttcgac ttcggctacg acgagatcgc ggccgcggtc       420
     gacaagacgc cggccgccgt acgccagatc gcgcaccgcg cccgcggaca cgtcgccgag       480
     cggcggccgc gggccgaggc cacccgctcc gagcgggagc acgtgatggc gacgttcctc       540
     gctgcggtcg cgaccggcga catccagagc ctgatggacg tgctcgcccc cgacgtcgtg       600
     ctggtcaccg acggcggagg ggtcaagaag gccgcgctcc gcccgatcct gggccgtgac       660
     aaggtggtcc gcttcctcgg tgcggtctcc gagggcctcg acgccgtcgc cgacgtggtc       720
     gtcgtcaacg gcgctcccgc gctgcggatc gtgctggacg gcgagctcga cacggtcgcc       780
     tcgatggtcg tcgaggacgg cctggtcacc ggcctctacg tcgtacgcaa cccggccaag       840
     ctggcccggc tcgacgccgt cgtcactctg acccgttga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page