(data stored in ACNUC1104 zone)

EMBL: CP000509.PE425

CP000509.PE425       Location/Qualifiers
FT   CDS_pept        462413..463492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0433"
FT                   /product="ABC transporter, periplasmic binding protein,
FT                   thiB subfamily"
FT                   /note="TIGRFAM: ABC transporter, periplasmic binding
FT                   protein, thiB subfamily; PFAM: extracellular solute-binding
FT                   protein, family 1; KEGG: sco:SCO5646 putative solute
FT                   binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79975"
FT                   /db_xref="GOA:A1SDU0"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU0"
FT                   /protein_id="ABL79975.1"
FT                   /translation="MRPIHALAPLAPLVALALAATGCSTIGNGSSGDESTASPGGEPGR
FT                   VVLVTHESFSLPKPLIKQFEQQSGYDLVVRASGDAGILTNKLVLTKGDPLGDVAFGIDN
FT                   TFASRALDEGVFAPYDAPLPDGADQYRLPGDDEHDLTPIDNASVCVNVDDTWFADHHLA
FT                   PPKTLDDLAAPEYQGLFVTPGAATSSPGLAFLLSTIAAYGEDGWQDYWARLMENGTKLT
FT                   AGWSDAYEVDFTQGGGQGDRPIVLSYDSSPAFTVADGESSTSALLDTCFRQVEYAGVLD
FT                   GAANPAGAEQLVDFLLSPEVQAALPESMYVFPVDSSVQLPKEWARFAKQPSDPFSVDPA
FT                   SIDEHRDEWLREWTDVTSR"
     atgagaccca tccatgccct ggcgccactg gcaccgctcg tcgcgctcgc cctggcggcg        60
     accggctgct cgaccatcgg aaacggctcg tccggcgacg agtcgacggc cagcccgggc       120
     ggcgagcccg ggcgggtcgt gctggtcacc cacgagtcgt tctcgctgcc caagccgctg       180
     atcaagcagt tcgagcagca gtccggctac gacctggtgg tccgcgcgtc cggcgacgcc       240
     gggatcctca ccaacaagct ggtgctgacc aagggcgacc cgctcggcga cgtggcgttc       300
     ggcatcgaca acaccttcgc ctcgcgggcg ctcgacgagg gcgtgttcgc gccgtacgac       360
     gctccgctgc cggacggcgc cgaccagtac cggttgccgg gtgacgacga gcacgacctc       420
     acgccgatcg acaacgccag cgtgtgcgtg aacgtcgacg acacctggtt cgccgaccac       480
     catctcgccc cgccgaagac cctggacgac ctggccgccc cggagtacca gggcctgttc       540
     gtcaccccgg gcgcggccac cagctcgccc ggcctggcgt tcctgctgag cacgatcgcg       600
     gcgtacggcg aggacggctg gcaggactac tgggcgcggc tgatggagaa cgggaccaag       660
     ctgacggccg gctggtccga cgcctacgag gtcgacttca cccagggcgg cggccagggt       720
     gaccggccga tcgtgctgtc ctacgactcc tcgccggcgt tcaccgtcgc cgacggggag       780
     tcgtcgacga gcgccctgct cgacacctgc ttccgccagg tggagtacgc cggcgtgctg       840
     gacggtgccg cgaaccccgc cggcgccgag cagctggtcg acttcctgct ctcgccggag       900
     gtgcaggccg cactgcccga gagcatgtac gtgttcccgg tcgactcctc ggtccagctg       960
     ccgaaggagt gggcccggtt cgcgaagcag ccgagcgacc cgttctcggt ggaccccgcg      1020
     tcgatcgacg agcaccgcga cgagtggctg cgcgagtgga ccgacgtgac ctctcgatga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page