(data stored in ACNUC1104 zone)

EMBL: CP000509.PE426

CP000509.PE426       Location/Qualifiers
FT   CDS_pept        463526..465160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0434"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sco:SCO5647 ABC transporter
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79976"
FT                   /db_xref="GOA:A1SDU1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU1"
FT                   /protein_id="ABL79976.1"
FT                   /translation="MRRSLELVGLAALPLAVLGVFFLLPVSGMVSEGFVTDGRFDPGGV
FT                   LEVLGRPRVHRVLWFTVWSSTVATLLAVLLGLPVAHLLHRRRFWGRRALRSLLLVPFVL
FT                   PTVVVGVAFRELIGEAGPLGFLGLDGSAVAIVAGLVFFNVAVVIRAVGAAWESLDPRPA
FT                   EAAAALGAGPAHVFRTVTLPALRPAIVSAASVVFLFCATAFGVVLTLGGLRYSSVETEI
FT                   YLLTTNLLDLQAAAALSILQLLAITALLVVTGRLRAVPDPALARSTRRPPRPAPGDWPG
FT                   LVATGLVLLLVGAPVAALVAGSLRVGDAWSLGNYRALTGEGTQHALLASATDALVTSLR
FT                   TAVDATWMSLSLGVLVTVVVTRRSRTRGERRARGLLDGLFMLPLGVSAVTLGFGFLITL
FT                   DRPPLDLRDSPLLVPIAQALVALPLVVRTLVPVLGGIDDRQRQAAASLGAGPLRTFATV
FT                   DLPAMWRPLTAAAGFAFAVSLGEFGATSFLAREDHPTLPIVIYHLIGHPGAMNYGMALA
FT                   ASVVLATTTALVMLAVDRLRVPSVGAF"
     atgaggcgct cgctcgagct ggtcgggctc gcggcgctgc cgctggccgt gctcggcgtg        60
     ttcttcctgc tcccggtcag cggcatggtc tccgagggct tcgtcaccga cggccgcttc       120
     gacccgggtg gggtgctcga ggtgctcggc cggccccggg tgcaccgggt gctgtggttc       180
     acggtctggt cctcgacggt cgcgaccctg ctcgccgtgc tcctcggcct gcccgtggcg       240
     cacctgctgc accggcgccg gttctggggc cggcgggcgc tgcgctcgct gctgctggtg       300
     ccgttcgtgc tgccgacggt ggtggtcggg gtcgcgttcc gcgagctgat cggcgaggcc       360
     gggccgttgg gcttcctcgg cctggacggc tcggccgtgg ccatcgtcgc cggcctcgtg       420
     ttcttcaacg tggcggtcgt gatccgggcg gtcggcgccg cctgggagtc cctcgacccg       480
     cggccggcgg aggcggccgc ggcgctcggt gcggggccgg cccacgtctt ccggaccgtc       540
     accctgcccg cgctgcgccc ggcgatcgtc agcgccgcca gcgtggtctt cctcttctgc       600
     gccaccgcgt tcggcgtggt gctcaccctg ggcgggctgc gctactcctc ggtcgagacc       660
     gagatctacc tgctcaccac gaacctgctc gacctccagg ccgcggcggc gctctcgatc       720
     ctccagctgc tcgcgatcac ggccctgctg gtggtgaccg gccggttgcg cgccgtaccc       780
     gacccggctc tggcccgctc cacccggcgc ccgccgcggc cggcgcccgg cgactggccc       840
     ggcctggtcg cgaccggcct ggtgctgctg ctggtggggg cgccggtggc cgccctggtc       900
     gccggctcgc tgcgggtcgg cgacgcgtgg agcctgggca actaccgcgc gctgaccggc       960
     gagggcacgc agcacgccct gctcgcctcc gcgaccgacg cgctcgtcac ctcgctgcgc      1020
     accgccgtcg acgccacctg gatgtcgctg tccctgggcg tgctggtcac cgtggtggtc      1080
     acccgccggt cgcgcacgcg gggtgagcgc cgggcgcgcg gcctgctgga cgggctgttc      1140
     atgctcccgc tcggggtgtc cgcggtgacg ctcggcttcg ggttcctcat caccctcgac      1200
     cggccgcccc tcgacctgag ggactcaccg ctcctggtcc cgatcgcgca ggcgctggtg      1260
     gcgctgccgc tcgtcgtccg gaccctggtg ccggtgctcg gtggcatcga cgaccgccag      1320
     cggcaggccg ccgcgtcgct cggtgccggc ccgttgcgta ccttcgccac cgtggacctc      1380
     cccgccatgt ggcggccgct gaccgccgcg gccggcttcg cgttcgcggt gtcgctcggt      1440
     gagttcgggg cgacctcgtt cctcgcccgg gaggaccacc ccacgctgcc gatcgtgatc      1500
     taccacctga tcgggcaccc gggtgcgatg aactacggca tggccctcgc cgcgtccgtc      1560
     gtcctcgcca ccacgaccgc gctcgtgatg ctcgccgtcg accggctgcg ggtgccgtcg      1620
     gtgggggcgt tctga                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page