(data stored in ACNUC1104 zone)

EMBL: CP000509.PE427

CP000509.PE427       Location/Qualifiers
FT   CDS_pept        465160..466158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0435"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sco:SCO5648 ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79977"
FT                   /db_xref="GOA:A1SDU2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU2"
FT                   /protein_id="ABL79977.1"
FT                   /translation="MLALDHLSVSYDGVPAVVDATLELADGHVLAVLGPSGSGKSTLLR
FT                   AVAGLEPAVAGRICWDGADLAHVPTHKRGFALMFQDGQLFNHLTVARNIGYALRLRRTP
FT                   RAAERVAELLALVGLEGYAERLPATLSGGERQRVALARSLAVAPRLLLLDEPLSALDAG
FT                   LRERLAVDLREILRAAGTTALMVTHDQEEAFAVADRLAVMRAGRIVQQGEIAEVWRAPA
FT                   DPETALFLGYARVLEGSAAAALLQAAGLPVAPAVAVRRSALVVADGAEAGPLRGAVVSA
FT                   RATPELIRLVVDVDTIGEVDAVARLGTHPGPGDPVRLSVDPSRLAPTPTGR"
     atgctggccc tggaccacct cagcgtctcg tacgacggcg tgccggctgt cgtcgacgcg        60
     acgctggagc tcgcggacgg gcacgtcctc gcggtcctgg ggccgagcgg ctcgggcaag       120
     tcgacgctgc tgcgcgcggt ggccgggctc gagccggccg tcgccgggcg gatctgctgg       180
     gacggtgccg acctcgccca cgtcccgacc cacaagcgcg ggttcgcgct gatgttccag       240
     gacgggcagc tgttcaacca cctcacggtc gcccgcaaca tcggctacgc gctgcggctc       300
     cggcgtaccc cccgggccgc ggagcgggtc gccgagctgc tcgccctggt cgggctcgag       360
     gggtacgccg agcgcctccc ggcgaccctg tccggtggcg agcgccagcg ggtggcgttg       420
     gcccgctcgc tcgcggtcgc cccgcggctg ctgctgctcg acgagccgct gtcggcactc       480
     gacgcggggc tgcgtgagcg gctcgccgtc gacctgcgtg agatcctgcg tgcggccggg       540
     accaccgcgc tgatggtcac ccacgaccag gaggaggcgt tcgcggtcgc cgaccggctg       600
     gcggtgatgc gcgccggccg gatcgtccag cagggcgaga tcgccgaggt ctggcgggcg       660
     ccggccgacc ccgagaccgc gctcttcctc gggtacgccc gcgtcctgga gggcagcgcc       720
     gcggccgcgc tcctgcaggc ggccgggctg cccgtcgccc cggcggtcgc cgtacgccgc       780
     tcggcgctcg tggtcgccga cggtgccgag gccgggcccc tccgcggcgc ggtcgtgtcg       840
     gcacgagcga ctccggagct gatccgcctg gtcgtcgacg tggacacgat cggcgaggtc       900
     gacgcggtgg cccggctggg cacgcacccc ggacccggcg acccggtccg gctgagcgtg       960
     gaccccagtc gcttggcccc gacgccgacc gggcggtga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page