(data stored in SCRATCH zone)

EMBL: CP000509.PE428

CP000509.PE428       Location/Qualifiers
FT   CDS_pept        466180..467241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1759 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79978"
FT                   /db_xref="GOA:A1SDU3"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU3"
FT                   /protein_id="ABL79978.1"
FT                   /translation="MPTLTPVYRRAYALLVGNAVVMGVLAIIVAIVYDKRLIDPEGSFL
FT                   GPSWLRLPLLLFGALLLDLLPRTLWFSKMDPRLMPGIVRERWRTHWNRERLTLVALGIV
FT                   CFYVVYVSYRNLKSFLPFVRDVMYDRELHYLDRALLFGHDPAHVLHGLLGEGFMAWPLS
FT                   YIYLWFLPLVPLAVTAWLVWSRNLSYGYWFVTSQCIAWSLGTASYYALPTLGPGLEYTW
FT                   LYDSLPTTPTSRLMESLAYGRNNVYWGVVQDAVQSVAGFASLHVAITLLVALMIQYTVR
FT                   SRALKWIFWVNFGVTVIATLYFGWHYLADDVAGVMIAFVSFYVGGLASGQKFDKHGLAS
FT                   HPTTTTSAVPVDR"
     ttgcctacac tgacccccgt gtatcgccgt gcctatgccc tgctcgtggg gaacgccgtg        60
     gtcatgggcg tgctggcgat catcgtcgcg atcgtctacg acaagcgcct gatcgacccg       120
     gagggcagct tcctcgggcc gtcctggctg cggctgccgc tgctgctgtt cggggcgctg       180
     ctgctggacc tgctgccgcg gaccctgtgg ttctccaaga tggacccgcg actgatgccc       240
     gggatcgtgc gcgagcgctg gcggacccac tggaaccggg agcggctgac cctggtggcg       300
     ctcgggatcg tctgcttcta cgtcgtctac gtcagctacc gcaacctgaa gtcgttcctg       360
     ccgttcgtgc gcgacgtcat gtacgaccgg gagctgcact acctcgaccg ggcactgctg       420
     ttcggccacg acccggcgca cgtgctccac gggctcctcg gcgagggctt catggcctgg       480
     ccgctgtcct acatctacct gtggttcctg ccgctggtgc cgctcgcggt caccgcgtgg       540
     ctcgtctggt cgcgcaacct gtcctacggc tactggttcg tgacctcgca gtgcatcgcg       600
     tggtccctgg gcacggcgtc gtactacgcg ctgccgacgc tcggccccgg cctggagtac       660
     acctggctct acgacagcct gccgaccacc ccgacgagca ggttgatgga gtcgctcgcc       720
     tacgggcgca acaacgtcta ctggggtgtc gtccaggacg ccgtgcagtc ggtggcgggc       780
     ttcgcgagcc tgcacgtcgc gatcacgctg ctggtcgcgc tgatgatcca gtacaccgtg       840
     cgctcccggg ccctgaagtg gatcttctgg gtgaacttcg gggtcaccgt catcgccacc       900
     ctctacttcg gctggcacta cctcgccgac gacgtcgccg gggtgatgat cgcgttcgtc       960
     tccttctacg tcggcgggct ggccagcggt cagaagttcg acaagcacgg cctcgcctcg      1020
     caccccacga cgacgacctc cgccgtcccc gtcgaccgct ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page