(data stored in ACNUC1104 zone)

EMBL: CP000509.PE434

CP000509.PE434       Location/Qualifiers
FT   CDS_pept        473580..474293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79984"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU9"
FT                   /protein_id="ABL79984.1"
FT                   /translation="MSHRRTFAAAVALLAAAVIAPQALPASASPAGRAVTAQRAGQALI
FT                   QGVVVDQAGRYVDDVEVQATKADGTPAASAITYASDREDGPQHGYFFLEVTRGTYTLTF
FT                   SRDGYRTLVLDDLQIERARQKLSLGEVEIQKKLAESKTEASLVRRTITTKQNGEVVVTV
FT                   SARGVKPTGDVEIREGRTVVGEDGLRARDNGQVTIELDRLPRGTHELKAYYLGSPDLKV
FT                   SASTSFTLTVTRGRH"
     atgtcccacc gccgtacctt cgccgccgcc gtcgcgctgc tggccgccgc ggtcatcgcg        60
     ccccaggcgc tgcccgcctc cgcgtcgccc gccggccggg ccgtgaccgc ccagcgggcc       120
     ggccaggcgc tcatccaggg cgttgtcgtc gaccaggccg gccgctacgt cgacgacgtc       180
     gaggtccagg cgaccaaggc cgacggcacc cctgcggcct ccgcgatcac ctacgccagc       240
     gaccgcgaag acggccccca gcacggctac ttcttcctcg aggtcacccg tgggacctac       300
     accctgacgt tctcgcgcga tgggtaccgg acgctcgttc tcgacgacct ccagatcgag       360
     agggctcgtc agaagctgag cctgggtgag gtcgagatcc agaagaagct ggcggagagc       420
     aagaccgagg ccagcctcgt gcggcgcacg atcacgacca agcagaacgg cgaggtcgtg       480
     gtgaccgtgt ccgcgagggg cgtcaagccc acgggcgacg tcgagatccg cgagggccgc       540
     accgtggtcg gcgaggacgg cctcagggcc agggacaacg gccaggtcac gatcgagctg       600
     gaccggttgc cccgcgggac ccacgagctc aaggcctact acctcggctc cccggacctg       660
     aaggtgtcgg cgtccacgtc cttcaccctg accgtcacca gggggcggca ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page