(data stored in ACNUC1104 zone)

EMBL: CP000509.PE436

CP000509.PE436       Location/Qualifiers
FT   CDS_pept        475120..477165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0444"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /note="KEGG: sma:SAV4666 putative cell division protein
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase, central domain protein;
FT                   peptidase M41, FtsH extracellular; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79986"
FT                   /db_xref="GOA:A1SDV1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDV1"
FT                   /protein_id="ABL79986.1"
FT                   /translation="MKRIFKGPWLWIVLAVVGVLLALQYLAPNRGGEEVDASKMQDLIS
FT                   SGEIKELTFVDGGEQQIKATLDNGDKVTAFWLDGTQAELDSQVQDQVDAGKIDSYTVEV
FT                   PKPSLLGSILATLLPFALIILLFLFLMNQVQGGGGRGVMQFAKSRAKLISKDMPKTTFG
FT                   DVAGCEEAIEELGEIKEFLQEPAKFQAVGAKIPKGVLLYGPPGTGKTLLARAVAGEAGV
FT                   PFYSISGSDFVEMFVGVGASRVRDLFEQAKENAPAIVFIDEIDAVGRHRGAGMGGGHDE
FT                   REQTLNQLLVEMDGFDVRGGVILIAATNRPDVLDPALLRPGRFDRQIQVDAPDLNGRHM
FT                   ILKVHSRGKPMSQDIDLLSVARRTPGFTGADLANVLNEAALLTARSNQKLITNANLDEA
FT                   IDRVIAGPQRRTRLMSEKEKLITAYHEGGHALVAAALPGTDPVHKITILPRGRALGYTM
FT                   VLPDEDKYSQTRSQMLDSLAYMLGGRAAEEMVFHDPTTGAGNDIEKATNLARAMVTQYG
FT                   MTERLGAIKLGESNSEPFLGRDLGHARNYSEDVAAIVDEETKKLLANAHQEAFEILEEN
FT                   RDVLDALVLELVEKETLDKQQVAEVFAPLRRRSERPAWTGSPERNPSAIPPVEIPQWIR
FT                   DRAAANGHSKEEGEAGPVLTPPGSGGDVHGDPGVGGAETPPGLPPH"
     gtgaagcgca tattcaaggg tccctggctg tggatcgtcc tcgccgtggt cggcgtcctg        60
     ctcgccctgc agtacctcgc gcccaaccgc gggggcgaag aggtggacgc ctcgaagatg       120
     caggacctca tcagctccgg tgagatcaag gagctgacct tcgtcgacgg cggcgagcag       180
     cagatcaagg ccaccctcga caacggcgac aaggtcaccg ccttctggct cgacgggacc       240
     caggcggagc tggactccca ggtccaggac caggtcgatg cgggcaagat cgactcctac       300
     acggtcgagg tgcccaagcc gagcctgctc ggctcgatcc tggcgacgct gctgccgttc       360
     gcgctgatca tcctgctctt cctgttcctc atgaaccagg tccagggcgg cggcggtcgc       420
     ggcgtcatgc agttcgcgaa gtcgcgcgcg aagctgatct ccaaggacat gccgaagacc       480
     acgttcggcg acgtcgccgg ttgcgaggag gcgatcgagg agctcgggga gatcaaggag       540
     ttcctccagg agcccgccaa gttccaggcg gtcggcgcca agatccccaa gggcgtgctg       600
     ctctacggcc cgcccggcac cggcaagacc ctgctggccc gggcggtcgc cggtgaggcg       660
     ggcgtcccgt tctactcgat ctccgggtcc gacttcgtcg agatgttcgt cggcgtcggc       720
     gcctcccggg tccgtgacct gttcgagcag gccaaggaga acgcgcccgc gatcgtgttc       780
     atcgacgaga tcgacgccgt cggtcgccac cgcggcgccg ggatgggcgg tggccacgac       840
     gagcgcgagc agaccttgaa ccagctgctg gtcgagatgg acggcttcga cgtccgcggc       900
     ggcgtgatcc tgatcgccgc caccaaccgg cccgacgtct tggacccggc gctgctgcgc       960
     cccggtcgct tcgaccgcca gatccaggtc gacgccccgg acctcaacgg ccggcacatg      1020
     atcctcaagg tccactcgcg cgggaagccg atgtcccagg acatcgacct gctctccgtg      1080
     gcccgtcgga cacccggctt caccggtgcc gacctggcca acgtgctcaa cgaggcggcg      1140
     ctgctgaccg cgcgcagcaa ccagaagctg atcaccaacg ccaacctcga cgaggccatc      1200
     gaccgggtga tcgcgggccc gcaacggcgt acccgcctga tgagcgagaa ggagaagctg      1260
     atcacggcct accacgaggg cggccacgcc ctggtggctg cggcgctgcc cggcaccgac      1320
     ccggtgcaca agatcacgat cctgccccgc ggccgggccc tcggctacac gatggtgctg      1380
     cccgacgagg acaagtactc ccagacccgg tcgcagatgc tcgactcgct ggcctacatg      1440
     ctcggcggcc gtgcggccga ggagatggtg ttccacgacc ccaccaccgg tgccggcaac      1500
     gacatcgaga aggccaccaa cctggcccgc gcgatggtca cccagtacgg catgaccgag      1560
     cggctcggcg cgatcaagct gggggagtcg aactccgagc cgttcttggg acgcgacctg      1620
     ggccacgccc gcaactactc cgaggacgtc gccgcgatcg tcgacgagga gaccaagaag      1680
     ctgctcgcga acgcccacca ggaggccttc gagatcctcg aggagaaccg cgacgtcctc      1740
     gacgcgctgg tgctcgagct agtcgagaag gagacgctgg acaagcagca ggtcgcggag      1800
     gtcttcgcgc ccctgcgccg ccggtccgag cggcccgcct ggacgggctc gcccgagcgc      1860
     aacccgtccg cgatcccgcc ggtggagatc ccgcagtgga tccgggaccg ggcggccgcc      1920
     aacggtcact ccaaggagga gggtgaggcc gggccggtgc tcaccccgcc gggatccggc      1980
     ggcgacgtgc acggtgaccc gggggtcggc ggcgccgaga cgcctccggg cctgccgccg      2040
     cactga                                                                 2046
//

If you have problems or comments...

PBIL Back to PBIL home page