(data stored in ACNUC1104 zone)

EMBL: CP000509.PE441

CP000509.PE441       Location/Qualifiers
FT   CDS_pept        479743..480234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO3402 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79991"
FT                   /db_xref="GOA:A1SDV6"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDV6"
FT                   /protein_id="ABL79991.1"
FT                   /translation="MSAGPSGEEPQPTGRLRPTSGGALTAWAVAGLVGGWLLHPAAERV
FT                   RDTAPIVTWAQPLALVLVAAILGATAYLTWRTVHVQQQRLEPQRAVNRLVLARSCALVG
FT                   ALVAGGYLGYAVSWIGVDTELATQRAWRSAVAAAAGVGIVVTSVLLERACRVRSDDEDT
FT                   "
     gtgagcgccg gaccctccgg cgaggagccg cagccgaccg gtcgcctgcg gccgacctct        60
     ggtggtgcgc tcacggcgtg ggccgtcgcg ggcctggtcg gcggatggct gctccacccc       120
     gcggccgaac gggtgcggga caccgcgccg atcgtcacct gggcccagcc gctcgcgctc       180
     gtgctcgtgg cggcgatcct gggcgccacg gcgtacctca cctggcgcac cgtgcacgtc       240
     cagcagcagc ggctcgagcc gcagcgtgcg gtcaaccgcc tggtgctcgc ccggtcctgc       300
     gcgctcgtgg gcgccctggt cgccggcggc tacctggggt acgccgtgag ctggatcggc       360
     gtggacaccg agctggccac ccagcgggcc tggcgctcgg ccgtcgccgc cgccgcgggc       420
     gtcggcatcg tggtcacctc ggtcctcctc gagcgcgcgt gtcgcgtccg atccgacgac       480
     gaagacactt aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page