(data stored in ACNUC1104 zone)

EMBL: CP000509.PE444

CP000509.PE444       Location/Qualifiers
FT   CDS_pept        complement(482221..483255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0452"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sma:SAV7409 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79994"
FT                   /db_xref="GOA:A1SDV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDV9"
FT                   /protein_id="ABL79994.1"
FT                   /translation="MDATGSAAAGPTSTEPMIRLSGVGKTYDDGTVAVHALDLEVERGE
FT                   LVCLVGPSGCGKSTTLKMINRLIEPTTGTIEIDGRDVTGQDPVRLRRGIGYVIQEVGLF
FT                   PHQKIIANVMTVPLLYGESRATARERARELLELVGLDPATYAERYPTQLSGGQQQRVGV
FT                   ARALAAKPPVLLMDEPFGAVDPLVRLRLQDEFLRLQRELGVTVVFVTHDIDEAVRLGDR
FT                   VAVFATGGRLAQYDTPARLLGRPADDFVAEFVGSTSGLRRLDVTPLDPAHLEPMDGVTA
FT                   GDLGAAIDVDSTLGHALAVLLRGDAGMVGVREGARFVGVLTPNGIHRALRAALAEMAEV
FT                   ASAG"
     atggacgcta ccgggtctgc ggcggccggg cccacgagca cggagcccat gatccggctg        60
     tcgggcgtcg gcaagaccta cgacgacggc acggtcgccg tccacgccct tgatctcgag       120
     gtcgagcgcg gcgagctggt ctgcctggtc ggcccatcgg ggtgcggcaa gtcgacgacg       180
     ctgaagatga tcaaccggtt gatcgagccg acgaccggca ccatcgagat cgacggccgg       240
     gacgtcaccg gccaggaccc ggtccggctg cgccggggga tcggctacgt catccaggag       300
     gtggggctgt tcccccacca gaagatcatc gccaacgtga tgacggtccc gctgctgtac       360
     ggcgagtccc gcgcgaccgc tcgggagcga gcccgcgagc tcctcgagct ggtggggctg       420
     gacccagcga cgtacgccga gcgctacccc acccagctct ccggcggcca gcagcagcgg       480
     gtcggggtcg cgcgggcgct ggcggccaag ccgccggtgc tcctgatgga cgagccgttc       540
     ggcgcggtcg acccgctggt gcggctgcgg ctgcaggacg agttcctgcg gctgcagcgc       600
     gagctcggcg tgaccgtggt gttcgtgacc cacgacatcg acgaggcggt ccggctcggg       660
     gaccgggtcg cggtcttcgc cacgggcggc cggctcgcgc agtacgacac cccggcccgg       720
     ctgctcgggc ggccggccga cgacttcgtg gcggagttcg tcggatcgac ctcggggctg       780
     cgacggctgg acgtcacccc gctcgacccg gcccacctcg aaccgatgga cggcgtcacc       840
     gccggtgacc tcggggccgc gatcgacgtc gacagcacgc tcgggcacgc gctggcagtg       900
     ctgctgcgcg gcgacgccgg gatggtcggg gtccgcgaag gcgcgcgctt cgtcggcgtg       960
     ctcaccccca acggcatcca ccgggcgctg cgcgcggccc tcgccgagat ggccgaggtc      1020
     gcctccgccg gctga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page