(data stored in ACNUC1104 zone)

EMBL: CP000509.PE449

CP000509.PE449       Location/Qualifiers
FT   CDS_pept        486894..487982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0457"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_3097 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79999"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDW4"
FT                   /protein_id="ABL79999.1"
FT                   /translation="MPADPSDVDPADYPRKVLFVAGAGRSGTSTMAGLMQIMGLHVPQP
FT                   EVVADETNPKGFGEPAWVVEHHDRLLKEAGVQVSDARPEAWFETGRVSTREPERIRTAE
FT                   WLDGHFAVNPELVVKDPRLSWFLSLWRVAAVRTGATPVFATMLRPPAEVVGSKQNYYQN
FT                   RLGSAHLAASWLNMLLHTERATRESVVDGGRVFVRYADLLDDWTRVVMHAGERLGLEHV
FT                   MHAKSEAIRNGHRFVDPSLRRMNQTLEDLALPPRLHELTAETWEELNKLAEPDGDTPAV
FT                   HEALDQLREGYVELYEEAAAISRSSVVAAEQRVRKQLKGGGGSRPAPAAPADPADRIPH
FT                   GVRAAIPAPVRRGLRKAMGRSR"
     gtgcccgccg accccagcga cgtcgacccc gccgactacc cgcgcaaggt cctgttcgtg        60
     gccggtgccg gccgcagcgg caccagcacc atggccgggc tgatgcagat catgggtctg       120
     cacgtcccgc agcccgaggt ggtcgccgac gagacgaacc cgaagggctt cggtgagccg       180
     gcgtgggtgg tcgagcacca cgatcgcctg ctgaaggagg ccggcgtcca ggtcagcgac       240
     gcgcgccccg aggcgtggtt cgagaccggc cgggtctcca cccgcgagcc ggagcggatc       300
     cggaccgcgg agtggctcga cgggcacttc gccgtgaacc ccgagctggt cgtcaaggac       360
     ccgcggctga gctggttcct ctcgctgtgg cgggtggccg ccgtgcgcac cggtgcgacg       420
     ccggtcttcg cgacgatgct gcggccgccg gcggaggtgg tcggcagcaa gcagaactac       480
     taccagaacc ggctcggctc ggcgcacctc gcggcctcct ggctgaacat gctgctgcac       540
     accgagcgcg cgacgcgtga gtcggtcgtc gacggcggcc gcgtcttcgt ccggtacgcc       600
     gacctcctcg acgactggac ccgggtggtg atgcacgctg gcgagcggct cggcctcgag       660
     cacgtcatgc acgccaagag cgaggccatc cgcaacggcc accgcttcgt cgaccccagt       720
     ctccgccgga tgaaccagac gctggaggac ctggccctgc cgccccggct gcacgagctc       780
     accgccgaga cctgggagga gctcaacaag ctcgccgagc ctgacgggga caccccggcg       840
     gtgcacgagg cgctcgacca gctccgcgag ggctacgtcg agctctacga ggaggctgcg       900
     gccatctcgc ggtcctcggt cgtcgccgcc gagcagcggg tccgcaagca gctcaagggc       960
     ggtggcggat ccaggcccgc accggccgcg cccgccgacc ccgccgatcg gatcccgcac      1020
     ggcgtgcgcg ccgcgatacc ggcgccggtg cgacgagggc tgcgcaaggc catgggccgg      1080
     agccggtga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page