(data stored in ACNUC1104 zone)

EMBL: CP000509.PE45

CP000509.PE45        Location/Qualifiers
FT   CDS_pept        50721..51641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0045"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79595"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR0"
FT                   /protein_id="ABL79595.1"
FT                   /translation="MSAARGVDDWSRTPDRAAQNETFGPRRVVVSDALVRRHAFVHDAA
FT                   VSAVSLPTGEVSPLVVGNDLLRIYEERHQRHADVGGLHLRESLQLLSPVWTGEVLELSG
FT                   RYAGWFPRGDVACLVVDAEAHGEDGRLIARARATESLPAAPDGVPERPPLPSLPRRVSP
FT                   SAGPVGEAAHPWRTPMPGARLPELRRRLEQEHLSVYSGGASFERNLHTDPDKAAERGYA
FT                   RPVAQGMHLCGLVDELCRQHLGVRWWLGGELDVRFVGPVLAGSPLVVGGAVVATDERGG
FT                   SRVEIDVWVTCGEDAVLVGVASAPR"
     gtgagtgccg cgcgcggcgt cgacgactgg tcccgcacgc cggaccgggc cgcccagaac        60
     gagaccttcg gcccacgccg ggtcgtcgtg agcgatgcgc tggtgcggcg ccacgccttc       120
     gtccacgacg ccgcggtctc ggcggtgagc ctgccgaccg gcgaggtgtc gcccctggtc       180
     gtgggcaacg acctgctgcg catctacgag gagcgtcacc agcgccacgc tgacgtcggt       240
     gggctgcacc tgcgcgagtc gctgcagctg ctgtcgcccg tgtggacagg ggaggtgctg       300
     gagctctccg gccggtacgc cggctggttt ccgcggggcg acgtggcgtg cctggtcgtc       360
     gatgccgaag cgcacggcga ggacggacgc ctgatcgcgc gggcgcgcgc gacggagtcg       420
     ctgccggccg ctcccgacgg tgtgcccgag cgcccgccgc tgcccagcct tccacgccgg       480
     gtgtctcctt cggcgggccc ggtgggcgag gccgcacacc cgtggcgcac accgatgccc       540
     ggcgcacggc ttcccgagct ccgccgccgg ctggagcagg agcacctctc ggtgtactcc       600
     gggggcgcgt cgttcgagcg gaacctgcac accgaccccg acaaggcggc cgagcgtggc       660
     tacgcgcgtc cggtggcgca gggcatgcac ctgtgcggct tggtggacga gctgtgccgc       720
     cagcacctcg gcgtgcggtg gtggctcggg ggcgagctcg acgtccggtt cgtgggaccg       780
     gtgctggccg gcagcccctt ggtggtcggc ggtgccgtgg tcgctaccga cgagcgcggc       840
     ggcagccggg tcgagatcga cgtctgggtc acctgcggtg aagacgccgt gctggtcgga       900
     gtggcctccg cgccgcgctg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page